Human Nppc/CNP/CNP2 ORF/cDNA clone-Lentivirus particle (NM_024409)

Cat. No.: vGMLP004949

Pre-made Human Nppc/CNP/CNP2 Lentiviral expression plasmid for Nppc lentivirus packaging, Nppc lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NPPC/Nppc/CNP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004949 Human Nppc Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004949
Gene Name Nppc
Accession Number NM_024409
Gene ID 4880
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 381 bp
Gene Alias CNP,CNP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCATCTCTCCCAGCTGCTGGCCTGCGCCCTGCTGCTCACGCTGCTCTCCCTCCGGCCCTCCGAAGCCAAGCCCGGGGCGCCGCCGAAGGTCCCGCGAACCCCGCCGGCAGAGGAGCTGGCCGAGCCGCAGGCTGCGGGCGGCGGTCAGAAGAAGGGCGACAAGGCTCCCGGGGGCGGGGGCGCCAATCTCAAGGGCGACCGGTCGCGACTGCTCCGGGACCTGCGCGTGGACACCAAGTCGCGGGCAGCGTGGGCTCGCCTTCTGCAAGAGCACCCCAACGCGCGCAAATACAAAGGAGCCAACAAGAAGGGCTTGTCCAAGGGCTGCTTCGGCCTCAAGCTGGACCGAATCGGCTCCATGAGCGGCCTGGGATGTTAG
ORF Protein Sequence MHLSQLLACALLLTLLSLRPSEAKPGAPPKVPRTPPAEELAEPQAAGGGQKKGDKAPGGGGANLKGDRSRLLRDLRVDTKSRAAWARLLQEHPNARKYKGANKKGLSKGCFGLKLDRIGSMSGLGC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T87689-Ab Anti-ANFC/ NPPC/ CNP functional antibody
    Target Antigen GM-Tg-g-T87689-Ag NPPC protein
    ORF Viral Vector pGMLP004949 Human Nppc Lentivirus plasmid
    ORF Viral Vector vGMLP004949 Human Nppc Lentivirus particle


    Target information

    Target ID GM-T87689
    Target Name NPPC
    Gene ID 4880, 18159, 717026, 114593, 101097827, 610169, 281356, 100057178
    Gene Symbol and Synonyms CNP,CNP2,lbab,NPPC
    Uniprot Accession P23582
    Uniprot Entry Name ANFC_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000163273
    Target Classification Not Available

    This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include the cardiac natriuretic peptides CNP-53, CNP-29 and CNP-22, which belong to the natriuretic family of peptides. The encoded peptides exhibit vasorelaxation activity in laboratory animals and elevated levels of CNP-22 have been observed in the plasma of chronic heart failure patients. [provided by RefSeq, Oct 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.