Human IAPP/DAP/IAP ORF/cDNA clone-Lentivirus plasmid (NM_000415)
Cat. No.: pGMLP004968
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IAPP/DAP/IAP Lentiviral expression plasmid for IAPP lentivirus packaging, IAPP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
IAPP/DAP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP004968 |
Gene Name | IAPP |
Accession Number | NM_000415 |
Gene ID | 3375 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 270 bp |
Gene Alias | DAP,IAP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGCATCCTGAAGCTGCAAGTATTTCTCATTGTGCTCTCTGTTGCATTGAACCATCTGAAAGCTACACCCATTGAAAGTCATCAGGTGGAAAAGCGGAAATGCAACACTGCCACATGTGCAACGCAGCGCCTGGCAAATTTTTTAGTTCATTCCAGCAACAACTTTGGTGCCATTCTCTCATCTACCAACGTGGGATCCAATACATATGGCAAGAGGAATGCAGTAGAGGTTTTAAAGAGAGAGCCACTGAATTACTTGCCCCTTTAG |
ORF Protein Sequence | MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T56269-Ab | Anti-IAPP/ DAP/ IAP functional antibody |
Target Antigen | GM-Tg-g-T56269-Ag | IAPP protein |
ORF Viral Vector | pGMLP004968 | Human IAPP Lentivirus plasmid |
ORF Viral Vector | vGMLP004968 | Human IAPP Lentivirus particle |
Target information
Target ID | GM-T56269 |
Target Name | IAPP |
Gene ID | 3375, 15874, 114670806, 24476, 751513, 403909, 100138011, 100629466 |
Gene Symbol and Synonyms | Amylin,DAP,IAP,IAPP |
Uniprot Accession | P10997 |
Uniprot Entry Name | IAPP_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000121351 |
Target Classification | Not Available |
This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity. [provided by RefSeq, Jul 2016]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.