Human IAPP/DAP/IAP ORF/cDNA clone-Lentivirus particle (NM_000415)

Cat. No.: vGMLP004968

Pre-made Human IAPP/DAP/IAP Lentiviral expression plasmid for IAPP lentivirus packaging, IAPP lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IAPP/DAP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004968 Human IAPP Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004968
Gene Name IAPP
Accession Number NM_000415
Gene ID 3375
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 270 bp
Gene Alias DAP,IAP
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCATCCTGAAGCTGCAAGTATTTCTCATTGTGCTCTCTGTTGCATTGAACCATCTGAAAGCTACACCCATTGAAAGTCATCAGGTGGAAAAGCGGAAATGCAACACTGCCACATGTGCAACGCAGCGCCTGGCAAATTTTTTAGTTCATTCCAGCAACAACTTTGGTGCCATTCTCTCATCTACCAACGTGGGATCCAATACATATGGCAAGAGGAATGCAGTAGAGGTTTTAAAGAGAGAGCCACTGAATTACTTGCCCCTTTAG
ORF Protein Sequence MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T56269-Ab Anti-IAPP/ DAP/ IAP functional antibody
    Target Antigen GM-Tg-g-T56269-Ag IAPP protein
    ORF Viral Vector pGMLP004968 Human IAPP Lentivirus plasmid
    ORF Viral Vector vGMLP004968 Human IAPP Lentivirus particle


    Target information

    Target ID GM-T56269
    Target Name IAPP
    Gene ID 3375, 15874, 114670806, 24476, 751513, 403909, 100138011, 100629466
    Gene Symbol and Synonyms Amylin,DAP,IAP,IAPP
    Uniprot Accession P10997
    Uniprot Entry Name IAPP_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000121351
    Target Classification Not Available

    This gene encodes a member of the calcitonin family of peptide hormones. This hormone is released from pancreatic beta cells following food intake to regulate blood glucose levels and act as a satiation signal. Human patients with type 1 and advanced type 2 diabetes exhibit reduced levels of the encoded hormone in blood and pancreas. This protein also exhibits a bactericidal, antimicrobial activity. [provided by RefSeq, Jul 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.