Human AQP10/AQPA_HUMAN ORF/cDNA clone-Lentivirus plasmid (NM_080429)
Cat. No.: pGMLP005010
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human AQP10/AQPA_HUMAN Lentiviral expression plasmid for AQP10 lentivirus packaging, AQP10 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
AQP10/AQPA_HUMAN products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP005010 |
Gene Name | AQP10 |
Accession Number | NM_080429 |
Gene ID | 89872 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 906 bp |
Gene Alias | AQPA_HUMAN |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGTCTTCACTCAGGCCCCGGCTGAAATCATGGGCCACCTCCGGATACGCAGCCTCCTGGCCCGGCAGTGCCTGGCAGAGTTTCTGGGTGTGTTTGTACTCATGCTCCTCACCCAAGGAGCTGTGGCCCAGGCTGTCACCAGTGGAGAAACCAAAGGCAACTTCTTCACCATGTTTCTGGCTGGCTCTCTGGCCGTTACGATAGCCATCTACGTGGGTGGTAACGTCTCAGGGGCCCACCTGAATCCAGCCTTCTCCCTGGCCATGTGCATCGTTGGACGCCTCCCCTGGGTCAAGCTCCCCATTTACATCTTGGTGCAGTTGCTGTCTGCTTTCTGTGCTTCGGGAGCCACCTATGTTCTCTACCATGATGCCCTACAGAACTATACAGGTGGGAACCTGACAGTGACTGGCCCCAAGGAGACAGCCTCCATTTTTGCCACCTATCCTGCCCCCTATCTGTCCCTGAACAATGGCTTCCTGGATCAGGTTCTGGGCACTGGGATGCTGATTGTGGGGCTCTTGGCCATCCTGGACAGACGGAACAAGGGAGTCCCTGCGGGTCTGGAGCCTGTGGTGGTGGGGATGCTGATCCTGGCCCTCGGGTTATCCATGGGTGCCAACTGCGGGATTCCACTCAACCCTGCCCGGGACCTGGGCCCACGTCTCTTCACCTACGTGGCTGGCTGGGGTCCTGAAGTCTTCAGTGCTGGTAATGGCTGGTGGTGGGTGCCTGTGGTGGCCCCTCTGGTGGGGGCCACCGTTGGCACAGCCACTTACCAGCTGTTGGTGGCTCTGCACCACCCTGAGGGCCCAGAGCCAGCTCAGGATCTGGTGTCTGCTCAACACAAAGCCTCAGAGTTGGAAACTCCTGCCTCAGCTCAGATGCTGGAGTGTAAGCTATGA |
ORF Protein Sequence | MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0077-Ab | Anti-AQP10/ AQPA_HUMAN monoclonal antibody |
Target Antigen | GM-Tg-g-MP0077-Ag | AQP10 VLP (virus-like particle) |
ORF Viral Vector | pGMLP005010 | Human AQP10 Lentivirus plasmid |
ORF Viral Vector | vGMLP005010 | Human AQP10 Lentivirus particle |
Target information
Target ID | GM-MP0077 |
Target Name | AQP10 |
Gene ID | 89872, 697815, 686596, 101097543, 612280, 785782, 100062408 |
Gene Symbol and Synonyms | AQP10,AQPA_HUMAN |
Uniprot Accession | Q96PS8 |
Uniprot Entry Name | AQP10_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000143595 |
Target Classification | Not Available |
This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.