Human AQP10/AQPA_HUMAN ORF/cDNA clone-Lentivirus plasmid (NM_080429)

Cat. No.: pGMLP005010
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human AQP10/AQPA_HUMAN Lentiviral expression plasmid for AQP10 lentivirus packaging, AQP10 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to AQP10/AQPA_HUMAN products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $526.5
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005010
Gene Name AQP10
Accession Number NM_080429
Gene ID 89872
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 906 bp
Gene Alias AQPA_HUMAN
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGTCTTCACTCAGGCCCCGGCTGAAATCATGGGCCACCTCCGGATACGCAGCCTCCTGGCCCGGCAGTGCCTGGCAGAGTTTCTGGGTGTGTTTGTACTCATGCTCCTCACCCAAGGAGCTGTGGCCCAGGCTGTCACCAGTGGAGAAACCAAAGGCAACTTCTTCACCATGTTTCTGGCTGGCTCTCTGGCCGTTACGATAGCCATCTACGTGGGTGGTAACGTCTCAGGGGCCCACCTGAATCCAGCCTTCTCCCTGGCCATGTGCATCGTTGGACGCCTCCCCTGGGTCAAGCTCCCCATTTACATCTTGGTGCAGTTGCTGTCTGCTTTCTGTGCTTCGGGAGCCACCTATGTTCTCTACCATGATGCCCTACAGAACTATACAGGTGGGAACCTGACAGTGACTGGCCCCAAGGAGACAGCCTCCATTTTTGCCACCTATCCTGCCCCCTATCTGTCCCTGAACAATGGCTTCCTGGATCAGGTTCTGGGCACTGGGATGCTGATTGTGGGGCTCTTGGCCATCCTGGACAGACGGAACAAGGGAGTCCCTGCGGGTCTGGAGCCTGTGGTGGTGGGGATGCTGATCCTGGCCCTCGGGTTATCCATGGGTGCCAACTGCGGGATTCCACTCAACCCTGCCCGGGACCTGGGCCCACGTCTCTTCACCTACGTGGCTGGCTGGGGTCCTGAAGTCTTCAGTGCTGGTAATGGCTGGTGGTGGGTGCCTGTGGTGGCCCCTCTGGTGGGGGCCACCGTTGGCACAGCCACTTACCAGCTGTTGGTGGCTCTGCACCACCCTGAGGGCCCAGAGCCAGCTCAGGATCTGGTGTCTGCTCAACACAAAGCCTCAGAGTTGGAAACTCCTGCCTCAGCTCAGATGCTGGAGTGTAAGCTATGA
ORF Protein Sequence MVFTQAPAEIMGHLRIRSLLARQCLAEFLGVFVLMLLTQGAVAQAVTSGETKGNFFTMFLAGSLAVTIAIYVGGNVSGAHLNPAFSLAMCIVGRLPWVKLPIYILVQLLSAFCASGATYVLYHDALQNYTGGNLTVTGPKETASIFATYPAPYLSLNNGFLDQVLGTGMLIVGLLAILDRRNKGVPAGLEPVVVGMLILALGLSMGANCGIPLNPARDLGPRLFTYVAGWGPEVFSAGNGWWWVPVVAPLVGATVGTATYQLLVALHHPEGPEPAQDLVSAQHKASELETPASAQMLECKL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0077-Ab Anti-AQP10/ AQPA_HUMAN monoclonal antibody
    Target Antigen GM-Tg-g-MP0077-Ag AQP10 VLP (virus-like particle)
    ORF Viral Vector pGMLP005010 Human AQP10 Lentivirus plasmid
    ORF Viral Vector vGMLP005010 Human AQP10 Lentivirus particle


    Target information

    Target ID GM-MP0077
    Target Name AQP10
    Gene ID 89872, 697815, 686596, 101097543, 612280, 785782, 100062408
    Gene Symbol and Synonyms AQP10,AQPA_HUMAN
    Uniprot Accession Q96PS8
    Uniprot Entry Name AQP10_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000143595
    Target Classification Not Available

    This gene encodes a member of the aquaglyceroporin family of integral membrane proteins. Members of this family function as water-permeable channels in the epithelia of organs that absorb and excrete water. This protein was shown to function as a water-selective channel, and could also permeate neutral solutes such as glycerol and urea. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.