Human OR6T1/OR11-277 ORF/cDNA clone-Lentivirus plasmid (NM_001005187)
Cat. No.: pGMLP005020
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human OR6T1/OR11-277 Lentiviral expression plasmid for OR6T1 lentivirus packaging, OR6T1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
OR6T1/OR11-277 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP005020 |
Gene Name | OR6T1 |
Accession Number | NM_001005187 |
Gene ID | 219874 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 972 bp |
Gene Alias | OR11-277 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAACCCTGAAAACTGGACTCAGGTAACAAGCTTTGTCCTTCTGGGTTTCCCCAGTAGCCACCTCATACAGTTCCTGGTGTTCCTGGGGTTAATGGTGACCTACATTGTAACAGCCACAGGCAAGCTGCTAATTATTGTGCTCAGCTGGATAGACCAACGCCTGCACATACAGATGTACTTCTTCCTGCGGAATTTCTCCTTCCTGGAGCTGTTGCTGGTAACTGTTGTGGTTCCCAAGATGCTTGTCGTCATCCTCACGGGGGATCACACCATCTCATTTGTCAGCTGCATCATCCAGTCCTACCTCTACTTCTTTCTAGGCACCACTGACTTCTTCCTCTTGGCCGTCATGTCTCTGGATCGTTACCTGGCAATCTGCCGACCACTCCGCTATGAGACCCTGATGAATGGCCATGTCTGTTCCCAACTAGTGCTGGCCTCCTGGCTAGCTGGATTCCTCTGGGTCCTTTGCCCCACTGTCCTCATGGCCAGCCTGCCTTTCTGTGGCCCCAATGGTATTGACCACTTCTTTCGTGACAGTTGGCCCTTGCTCAGGCTTTCTTGTGGGGACACCCACCTGCTGAAACTGGTGGCTTTCATGCTCTCTACGTTGGTGTTACTGGGCTCACTGGCTCTGACCTCAGTTTCCTATGCCTGCATTCTTGCCACTGTTCTCAGGGCCCCTACAGCTGCTGAGCGAAGGAAAGCGTTTTCCACTTGCGCCTCGCATCTTACAGTGGTGGTCATCATCTATGGCAGTTCCATCTTTCTCTACATTCGTATGTCAGAGGCTCAGTCCAAACTGCTCAACAAAGGTGCCTCCGTCCTGAGCTGCATCATCACACCCCTCTTGAACCCATTCATCTTCACTCTCCGCAATGACAAGGTGCAGCAAGCACTGAGAGAAGCCTTGGGGTGGCCCAGGCTCACTGCTGTGATGAAACTGAGGGTCACAAGTCAAAGGAAATGA |
ORF Protein Sequence | MNPENWTQVTSFVLLGFPSSHLIQFLVFLGLMVTYIVTATGKLLIIVLSWIDQRLHIQMYFFLRNFSFLELLLVTVVVPKMLVVILTGDHTISFVSCIIQSYLYFFLGTTDFFLLAVMSLDRYLAICRPLRYETLMNGHVCSQLVLASWLAGFLWVLCPTVLMASLPFCGPNGIDHFFRDSWPLLRLSCGDTHLLKLVAFMLSTLVLLGSLALTSVSYACILATVLRAPTAAERRKAFSTCASHLTVVVIIYGSSIFLYIRMSEAQSKLLNKGASVLSCIITPLLNPFIFTLRNDKVQQALREALGWPRLTAVMKLRVTSQRK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP1257-Ab | Anti-OR6T1/ OR11-277 monoclonal antibody |
Target Antigen | GM-Tg-g-MP1257-Ag | OR6T1 VLP (virus-like particle) |
ORF Viral Vector | pGMLP005020 | Human OR6T1 Lentivirus plasmid |
ORF Viral Vector | vGMLP005020 | Human OR6T1 Lentivirus particle |
Target information
Target ID | GM-MP1257 |
Target Name | OR6T1 |
Gene ID | 219874, 709477, 101093798, 100071802 |
Gene Symbol and Synonyms | LOC101093798,LOC709477,OR11-277,OR6T1 |
Uniprot Accession | Q8NGN1 |
Uniprot Entry Name | OR6T1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000181499 |
Target Classification | Not Available |
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.