Human CCL4/ACT2/AT744.1 ORF/cDNA clone-Lentivirus plasmid (NM_002984)

Cat. No.: pGMLP005055
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCL4/ACT2/AT744.1 Lentiviral expression plasmid for CCL4 lentivirus packaging, CCL4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCL4/ACT2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005055
Gene Name CCL4
Accession Number NM_002984
Gene ID 6351
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 279 bp
Gene Alias ACT2,AT744.1,G-26,HC21,LAG-1,LAG1,MIP-1-beta,MIP1B,MIP1B1,SCYA2,SCYA4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGCTCTGCGTGACTGTCCTGTCTCTCCTCATGCTAGTAGCTGCCTTCTGCTCTCCAGCGCTCTCAGCACCAATGGGCTCAGACCCTCCCACCGCCTGCTGCTTTTCTTACACCGCGAGGAAGCTTCCTCGCAACTTTGTGGTAGATTACTATGAGACCAGCAGCCTCTGCTCCCAGCCAGCTGTGGTATTCCAAACCAAAAGAAGCAAGCAAGTCTGTGCTGATCCCAGTGAATCCTGGGTCCAGGAGTACGTGTATGACCTGGAACTGAACTGA
ORF Protein Sequence MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0071-Ab Anti-CCL4/ ACT2/ AT744.1 functional antibody
    Target Antigen GM-Tg-g-SE0071-Ag CCL4 protein
    ORF Viral Vector pGMLP005055 Human CCL4 Lentivirus plasmid
    ORF Viral Vector vGMLP005055 Human CCL4 Lentivirus particle


    Target information

    Target ID GM-SE0071
    Target Name CCL4
    Gene ID 6351, 414347, 100057859
    Gene Symbol and Synonyms ACT2,AT744.1,CCL4,G-26,HC21,LAG-1,LAG1,MIP-1-beta,MIP1B,MIP1B1,SCYA2,SCYA4
    Uniprot Accession P13236
    Uniprot Entry Name CCL4_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Breast Cancer
    Gene Ensembl ENSG00000275302
    Target Classification Not Available

    The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.