Human CCL4/ACT2/AT744.1 ORF/cDNA clone-Lentivirus particle (NM_002984)
Cat. No.: vGMLP005055
Pre-made Human CCL4/ACT2/AT744.1 Lentiviral expression plasmid for CCL4 lentivirus packaging, CCL4 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CCL4/ACT2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP005055 | Human CCL4 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP005055 |
Gene Name | CCL4 |
Accession Number | NM_002984 |
Gene ID | 6351 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 279 bp |
Gene Alias | ACT2,AT744.1,G-26,HC21,LAG-1,LAG1,MIP-1-beta,MIP1B,MIP1B1,SCYA2,SCYA4 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAAGCTCTGCGTGACTGTCCTGTCTCTCCTCATGCTAGTAGCTGCCTTCTGCTCTCCAGCGCTCTCAGCACCAATGGGCTCAGACCCTCCCACCGCCTGCTGCTTTTCTTACACCGCGAGGAAGCTTCCTCGCAACTTTGTGGTAGATTACTATGAGACCAGCAGCCTCTGCTCCCAGCCAGCTGTGGTATTCCAAACCAAAAGAAGCAAGCAAGTCTGTGCTGATCCCAGTGAATCCTGGGTCCAGGAGTACGTGTATGACCTGGAACTGAACTGA |
ORF Protein Sequence | MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-SE0071-Ab | Anti-CCL4/ ACT2/ AT744.1 functional antibody |
Target Antigen | GM-Tg-g-SE0071-Ag | CCL4 protein |
ORF Viral Vector | pGMLP005055 | Human CCL4 Lentivirus plasmid |
ORF Viral Vector | vGMLP005055 | Human CCL4 Lentivirus particle |
Target information
Target ID | GM-SE0071 |
Target Name | CCL4 |
Gene ID | 6351, 414347, 100057859 |
Gene Symbol and Synonyms | ACT2,AT744.1,CCL4,G-26,HC21,LAG-1,LAG1,MIP-1-beta,MIP1B,MIP1B1,SCYA2,SCYA4 |
Uniprot Accession | P13236 |
Uniprot Entry Name | CCL4_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Not Available |
Disease | Breast Cancer |
Gene Ensembl | ENSG00000275302 |
Target Classification | Not Available |
The protein encoded by this gene is a mitogen-inducible monokine and is one of the major HIV-suppressive factors produced by CD8+ T-cells. The encoded protein is secreted and has chemokinetic and inflammatory functions. [provided by RefSeq, Dec 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.