Human JPH2/CMH17/JP-2 ORF/cDNA clone-Lentivirus plasmid (NM_175913)

Cat. No.: pGMLP005076
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human JPH2/CMH17/JP-2 Lentiviral expression plasmid for JPH2 lentivirus packaging, JPH2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to JPH2/CMH17 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $450
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005076
Gene Name JPH2
Accession Number NM_175913
Gene ID 57158
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 390 bp
Gene Alias CMH17,JP-2,JP2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTGGGGGCCGCTTCGACTTTGATGATGGAGGGGCGTACTGCGGGGGCTGGGAGGGGGGAAAGGCCCATGGGCATGGACTGTGCACAGGCCCCAAGGGCCAGGGCGAATACTCTGGCTCCTGGAACTTTGGCTTTGAGGTGGCAGGTGTCTACACCTGGCCCAGCGGAAACACCTTTGAGGGATACTGGAGCCAGGGCAAACGGCATGGGCTGGGCATAGAGACCAAGGGGCGCTGGCTCTACAAGGGCGAGTGGACACATGGCTTCAAGGGACGCTACGGAATCCGGCAGAGCTCAAGCAGCGGTGCCAAGTATGAGGGCACCTGGAACAATGGCCTGCAAGACGGCTATGGCACCGAGACCTATGCTGATGGAGGGATGTGTTAA
ORF Protein Sequence MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTFEGYWSQGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSSSSGAKYEGTWNNGLQDGYGTETYADGGMC

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0652-Ab Anti-JPH2/ CMH17/ JP-2 monoclonal antibody
    Target Antigen GM-Tg-g-MP0652-Ag JPH2 VLP (virus-like particle)
    ORF Viral Vector pGMLP005076 Human JPH2 Lentivirus plasmid
    ORF Viral Vector pGMLV000973 Human JPH2 Lentivirus plasmid
    ORF Viral Vector vGMLP005076 Human JPH2 Lentivirus particle
    ORF Viral Vector vGMLV000973 Human JPH2 Lentivirus particle


    Target information

    Target ID GM-MP0652
    Target Name JPH2
    Gene ID 57158, 59091, 694158, 296345, 102899147, 610874, 614651, 106782408
    Gene Symbol and Synonyms 1110002E14Rik,CMD2E,CMH17,JP-2,JP2,JPH2
    Uniprot Accession Q9BR39
    Uniprot Entry Name JPH2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000149596
    Target Classification Not Available

    Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. The protein encoded by this gene is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. This gene is a member of the junctophilin gene family. Alternative splicing has been observed at this locus and two variants encoding distinct isoforms are described. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.