Human JPH2/CMH17/JP-2 ORF/cDNA clone-Lentivirus plasmid (NM_175913)
Cat. No.: pGMLP005076
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human JPH2/CMH17/JP-2 Lentiviral expression plasmid for JPH2 lentivirus packaging, JPH2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
JPH2/CMH17 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP005076 |
Gene Name | JPH2 |
Accession Number | NM_175913 |
Gene ID | 57158 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 390 bp |
Gene Alias | CMH17,JP-2,JP2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGTGGGGGCCGCTTCGACTTTGATGATGGAGGGGCGTACTGCGGGGGCTGGGAGGGGGGAAAGGCCCATGGGCATGGACTGTGCACAGGCCCCAAGGGCCAGGGCGAATACTCTGGCTCCTGGAACTTTGGCTTTGAGGTGGCAGGTGTCTACACCTGGCCCAGCGGAAACACCTTTGAGGGATACTGGAGCCAGGGCAAACGGCATGGGCTGGGCATAGAGACCAAGGGGCGCTGGCTCTACAAGGGCGAGTGGACACATGGCTTCAAGGGACGCTACGGAATCCGGCAGAGCTCAAGCAGCGGTGCCAAGTATGAGGGCACCTGGAACAATGGCCTGCAAGACGGCTATGGCACCGAGACCTATGCTGATGGAGGGATGTGTTAA |
ORF Protein Sequence | MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFGFEVAGVYTWPSGNTFEGYWSQGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSSSSGAKYEGTWNNGLQDGYGTETYADGGMC |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0652-Ab | Anti-JPH2/ CMH17/ JP-2 monoclonal antibody |
Target Antigen | GM-Tg-g-MP0652-Ag | JPH2 VLP (virus-like particle) |
ORF Viral Vector | pGMLP005076 | Human JPH2 Lentivirus plasmid |
ORF Viral Vector | pGMLV000973 | Human JPH2 Lentivirus plasmid |
ORF Viral Vector | vGMLP005076 | Human JPH2 Lentivirus particle |
ORF Viral Vector | vGMLV000973 | Human JPH2 Lentivirus particle |
Target information
Target ID | GM-MP0652 |
Target Name | JPH2 |
Gene ID | 57158, 59091, 694158, 296345, 102899147, 610874, 614651, 106782408 |
Gene Symbol and Synonyms | 1110002E14Rik,CMD2E,CMH17,JP-2,JP2,JPH2 |
Uniprot Accession | Q9BR39 |
Uniprot Entry Name | JPH2_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000149596 |
Target Classification | Not Available |
Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. The protein encoded by this gene is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. This gene is a member of the junctophilin gene family. Alternative splicing has been observed at this locus and two variants encoding distinct isoforms are described. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.