Human CLDN12 ORF/cDNA clone-Lentivirus plasmid (NM_012129)

Cat. No.: pGMLP005130
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CLDN12/ Lentiviral expression plasmid for CLDN12 lentivirus packaging, CLDN12 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to CLDN12/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $483.75
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005130
Gene Name CLDN12
Accession Number NM_012129
Gene ID 9069
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 735 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGCTGTCGGGATGTCCACGCAGCCACAGTCCTTTCCTTCCTGTGTGGAATCGCCTCAGTAGCAGGCCTCTTTGCAGGGACTCTGCTTCCCAACTGGAGAAAATTACGATTGATCACATTCAACAGAAACGAGAAGAACCTGACTGTTTACACAGGCCTGTGGGTGAAATGTGCCCGGTATGACGGGAGCAGTGACTGCCTGATGTACGACACTACTTGGTACTCATCAGTTGACCAGCTGGACCTGCGTGTCCTCCAGTTTGCCCTACCCCTCAGCATGCTGATCGCCATGGGTGCCCTGCTGCTCTGCCTGATTGGAATGTGCAACACTGCCTTCAGGTCCTCGGTGCCCAACATCAAACTGGCCAAGTGTCTGGTCAATAGTGCAGGTTGCCACCTGGTGGCTGGGCTGCTATTTTTCCTGGCAGGTACTGTGAGCCTCTCCCCATCTATCTGGGTCATCTTTTATAACATCCATCTGAACAAGAAGTTTGAGCCAGTCTTTTCATTTGACTATGCAGTGTATGTCACTATTGCTAGTGCTGGGGGCCTGTTTATGACTTCCCTTATACTATTTATTTGGTATTGTACATGCAAATCTTTGCCTTCTCCTTTCTGGCAACCATTGTACTCCCATCCACCCAGTATGCATACTTACTCACAGCCCTATTCAGCACGCTCTCGCCTCTCTGCCATTGAAATTGACATTCCAGTAGTTTCACACACCACTTAA
ORF Protein Sequence MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLIAMGALLLCLIGMCNTAFRSSVPNIKLAKCLVNSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0273-Ab Anti-CLD12/ CLDN12 monoclonal antibody
    Target Antigen GM-Tg-g-MP0273-Ag CLDN12 VLP (virus-like particle)
    ORF Viral Vector pGMLP005130 Human CLDN12 Lentivirus plasmid
    ORF Viral Vector vGMLP005130 Human CLDN12 Lentivirus particle


    Target information

    Target ID GM-MP0273
    Target Name CLDN12
    Gene ID 9069, 64945, 704058, 500000, 101081208, 608397, 112446354, 100060361
    Gene Symbol and Synonyms claudin-12,CLDN12,RGD1561053
    Uniprot Accession P56749
    Uniprot Entry Name CLD12_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000157224
    Target Classification Not Available

    This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is expressed in the inner ear and bladder epithelium, and it is over-expressed in colorectal carcinomas. This protein and claudin 2 are critical for vitamin D-dependent Ca2+ absorption between enterocytes. Multiple alternatively spliced transcript variants encoding the same protein have been found.[provided by RefSeq, Sep 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.