Human PDGFRL/PDGRL/PRLTS ORF/cDNA clone-Lentivirus plasmid (NM_006207.2)

Cat. No.: pGMLP005251
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PDGFRL/PDGRL/PRLTS Lentiviral expression plasmid for PDGFRL lentivirus packaging, PDGFRL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to PDGFRL/PDGRL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $615.84
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP005251
Gene Name PDGFRL
Accession Number NM_006207.2
Gene ID 5157
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1128 bp
Gene Alias PDGRL,PRLTS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGGTCTGGCTGCTGCTTGGTCTTCTGCTGGTGCACGAAGCGCTGGAGGATGTTACTGGCCAACACCTTCCCAAGAACAAGCGTCCAAAAGAACCAGGAGAGAATAGAATCAAACCTACCAACAAGAAGGTGAAGCCCAAAATTCCTAAAATGAAGGACAGGGACTCAGCCAATTCAGCACCAAAGACGCAGTCTATCATGATGCAAGTGCTGGATAAAGGTCGCTTCCAGAAACCCGCCGCTACCCTGAGTCTGCTGGCGGGGCAAACTGTAGAGCTTCGATGTAAAGGGAGTAGAATTGGGTGGAGCTACCCTGCGTATCTGGACACCTTTAAGGATTCTCGCCTCAGCGTCAAGCAGAATGAGCGCTACGGCCAGTTGACTCTGGTCAACTCCACCTCGGCAGACACAGGTGAATTCAGCTGCTGGGTGCAGCTCTGCAGCGGCTACATCTGCAGGAAGGACGAGGCCAAAACGGGCTCCACCTACATCTTTTTTACAGAGAAAGGAGAACTCTTTGTACCTTCTCCCAGCTACTTCGATGTTGTCTACTTGAACCCGGACAGACAGGCTGTGGTTCCTTGTCGGGTGACCGTGCTGTCGGCCAAAGTCACGCTCCACAGGGAATTCCCAGCCAAGGAGATCCCAGCCAATGGAACGGACATTGTTTATGACATGAAGCGGGGCTTTGTGTATCTGCAACCTCATTCCGAGCACCAGGGTGTGGTTTACTGCAGGGCGGAGGCCGGGGGCAGATCTCAGATCTCCGTCAAGTACCAGCTGCTCTACGTGGCGGTTCCCAGTGGCCCTCCCTCAACAACCATCTTGGCTTCTTCAAACAAAGTGAAAAGTGGGGACGACATCAGTGTGCTCTGCACTGTCCTGGGGGAGCCCGATGTGGAGGTGGAGTTCACCTGGATCTTCCCAGGGCAGAAGGATGAAAGGCCTGTGACGATCCAAGACACTTGGAGGTTGATCCACAGAGGACTGGGACACACCACGAGAATCTCCCAGAGTGTCATTACAGTGGAAGACTTTGAGACGATTGATGCAGGATATTACATTTGCACTGCTCAGAATCTTCAAGGACAGACCACAGTAGCTACCACTGTTGAGTTTTCCTGA
ORF Protein Sequence MKVWLLLGLLLVHEALEDVTGQHLPKNKRPKEPGENRIKPTNKKVKPKIPKMKDRDSANSAPKTQSIMMQVLDKGRFQKPAATLSLLAGQTVELRCKGSRIGWSYPAYLDTFKDSRLSVKQNERYGQLTLVNSTSADTGEFSCWVQLCSGYICRKDEAKTGSTYIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTVLSAKVTLHREFPAKEIPANGTDIVYDMKRGFVYLQPHSEHQGVVYCRAEAGGRSQISVKYQLLYVAVPSGPPSTTILASSNKVKSGDDISVLCTVLGEPDVEVEFTWIFPGQKDERPVTIQDTWRLIHRGLGHTTRISQSVITVEDFETIDAGYYICTAQNLQGQTTVATTVEFS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE1177-Ab Anti-PGFRL/ PDGFRL/ PDGRL functional antibody
    Target Antigen GM-Tg-g-SE1177-Ag PDGFRL protein
    Cytokine cks-Tg-g-GM-SE1177 platelet-derived growth factor receptor-like (PDGFRL) protein & antibody
    ORF Viral Vector pGMLP005251 Human PDGFRL Lentivirus plasmid
    ORF Viral Vector vGMLP005251 Human PDGFRL Lentivirus particle


    Target information

    Target ID GM-SE1177
    Target Name PDGFRL
    Gene ID 5157, 68797, 703117, 290771, 101083001, 607033, 515017, 100050306
    Gene Symbol and Synonyms 1110039P19Rik,PDGFRL,PDGRL,PRLTS
    Uniprot Accession Q15198
    Uniprot Entry Name PGFRL_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Cancer
    Gene Ensembl ENSG00000104213
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a protein with significant sequence similarity to the ligand binding domain of platelet-derived growth factor receptor beta. Mutations in this gene, or deletion of a chromosomal segment containing this gene, are associated with sporadic hepatocellular carcinomas, colorectal cancers, and non-small cell lung cancers. This suggests this gene product may function as a tumor suppressor. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.