Human VRK1/PCH1/PCH1A ORF/cDNA clone-Lentivirus plasmid (NM_003384.2)
Cat. No.: pGMLP005477
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human VRK1/PCH1/PCH1A Lentiviral expression plasmid for VRK1 lentivirus packaging, VRK1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
VRK1/PCH1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP005477 |
Gene Name | VRK1 |
Accession Number | NM_003384.2 |
Gene ID | 7443 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 1191 bp |
Gene Alias | PCH1,PCH1A |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCTCGTGTAAAAGCAGCTCAAGCTGGAAGACAGAGCTCTGCAAAGAGACATCTTGCAGAACAATTTGCAGTTGGAGAGATAATAACTGACATGGCAAAAAAGGAATGGAAAGTAGGATTACCCATTGGCCAAGGAGGCTTTGGCTGTATATATCTTGCTGATATGAATTCTTCAGAGTCAGTTGGCAGTGATGCACCTTGTGTTGTAAAAGTGGAACCCAGTGACAATGGACCTCTTTTTACTGAATTAAAGTTCTACCAACGAGCTGCAAAACCAGAGCAAATTCAGAAATGGATTCGTACCCGTAAGCTGAAGTACCTGGGTGTTCCTAAGTATTGGGGGTCTGGTCTACATGACAAAAATGGAAAAAGTTACAGGTTTATGATAATGGATCGCTTTGGGAGTGACCTTCAGAAAATATATGAAGCAAATGCCAAAAGGTTTTCTCGGAAAACTGTCTTGCAGCTAAGCTTAAGAATTCTGGATATTCTGGAATATATTCACGAGCATGAGTATGTGCATGGAGATATCAAGGCCTCAAATCTTCTTCTGAACTACAAGAATCCTGACCAGGTGTACTTGGTAGATTATGGCCTTGCTTATCGGTACTGCCCAGAAGGAGTTCATAAAGAATACAAAGAAGACCCCAAAAGATGTCACGATGGCACTATTGAATTCACGAGCATCGATGCACACAATGGCGTGGCCCCATCAAGACGTGGTGATTTGGAAATACTTGGTTATTGCATGATCCAATGGCTTACTGGCCATCTTCCTTGGGAGGATAATTTGAAAGATCCTAAATATGTTAGAGATTCCAAAATTAGATACAGAGAAAATATTGCAAGTTTGATGGACAAATGTTTTCCTGAGAAAAACAAACCAGGTGAAATTGCCAAATACATGGAAACAGTGAAATTACTAGACTACACTGAAAAACCTCTTTATGAAAATTTACGTGACATTCTTTTGCAAGGACTAAAAGCTATAGGAAGTAAGGATGATGGCAAATTGGACCTCAGTGTTGTGGAGAATGGAGGTTTGAAAGCAAAAACAATAACAAAGAAGCGAAAGAAAGAAATTGAAGAAAGCAAGGAACCTGGTGTTGAAGATACGGAATGGTCAAACACACAGACAGAGGAGGCCATACAGACCCGTTCAAGAACCAGAAAGAGAGTCCAGAAGTAA |
ORF Protein Sequence | MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVVKVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQKIYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVHKEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRENIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2261-Ab | Anti-VRK1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2261-Ag | VRK1 protein |
ORF Viral Vector | pGMLP005477 | Human VRK1 Lentivirus plasmid |
ORF Viral Vector | vGMLP005477 | Human VRK1 Lentivirus particle |
Target information
Target ID | GM-IP2261 |
Target Name | VRK1 |
Gene ID | 7443, 22367, 704798, 362779, 101091879, 490848, 618880, 100050033 |
Gene Symbol and Synonyms | 51PK,PCH1,PCH1A,VRK1 |
Uniprot Accession | Q99986 |
Uniprot Entry Name | VRK1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000100749 |
Target Classification | Not Available |
This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.