Human NRAS/ALPS4/CMNS ORF/cDNA clone-Lentivirus plasmid (NM_002524.4)
Cat. No.: pGMLP005789
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human NRAS/ALPS4/CMNS Lentiviral expression plasmid for NRAS lentivirus packaging, NRAS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
NRAS/ALPS4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLP005789 |
Gene Name | NRAS |
Accession Number | NM_002524.4 |
Gene ID | 4893 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 570 bp |
Gene Alias | ALPS4,CMNS,N-ras,NCMS,NRAS1,NS6 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACTGAGTACAAACTGGTGGTGGTTGGAGCAGGTGGTGTTGGGAAAAGCGCACTGACAATCCAGCTAATCCAGAACCACTTTGTAGATGAATATGATCCCACCATAGAGGATTCTTACAGAAAACAAGTGGTTATAGATGGTGAAACCTGTTTGTTGGACATACTGGATACAGCTGGACAAGAAGAGTACAGTGCCATGAGAGACCAATACATGAGGACAGGCGAAGGCTTCCTCTGTGTATTTGCCATCAATAATAGCAAGTCATTTGCGGATATTAACCTCTACAGGGAGCAGATTAAGCGAGTAAAAGACTCGGATGATGTACCTATGGTGCTAGTGGGAAACAAGTGTGATTTGCCAACAAGGACAGTTGATACAAAACAAGCCCACGAACTGGCCAAGAGTTACGGGATTCCATTCATTGAAACCTCAGCCAAGACCAGACAGGGTGTTGAAGATGCTTTTTACACACTGGTAAGAGAAATACGCCAGTACCGAATGAAAAAACTCAACAGCAGTGATGATGGGACTCAGGGTTGTATGGGATTGCCATGTGTGGTGATGTAA |
ORF Protein Sequence | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T35486-Ab | Anti-NRAS monoclonal antibody |
Target Antigen | GM-Tg-g-T35486-Ag | NRAS protein |
ORF Viral Vector | pGMLP000874 | Human NRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005597 | Human NRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005783 | Human NRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005784 | Human NRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005785 | Human NRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005786 | Human NRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005787 | Human NRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005788 | Human NRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005789 | Human NRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005790 | Human NRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP-SPh-053 | Human NRas Lentivirus plasmid |
ORF Viral Vector | pGMAP-SPh-193 | Human NRas Adenovirus plasmid |
ORF Viral Vector | vGMLP000874 | Human NRAS Lentivirus particle |
ORF Viral Vector | vGMLP005597 | Human NRAS Lentivirus particle |
ORF Viral Vector | vGMLP005783 | Human NRAS Lentivirus particle |
ORF Viral Vector | vGMLP005784 | Human NRAS Lentivirus particle |
ORF Viral Vector | vGMLP005785 | Human NRAS Lentivirus particle |
ORF Viral Vector | vGMLP005786 | Human NRAS Lentivirus particle |
ORF Viral Vector | vGMLP005787 | Human NRAS Lentivirus particle |
ORF Viral Vector | vGMLP005788 | Human NRAS Lentivirus particle |
ORF Viral Vector | vGMLP005789 | Human NRAS Lentivirus particle |
ORF Viral Vector | vGMLP005790 | Human NRAS Lentivirus particle |
ORF Viral Vector | vGMLP-SPh-053 | Human NRas Lentivirus particle |
ORF Viral Vector | vGMAP-SPh-193 | Human NRas Adenovirus particle |
Target information
Target ID | GM-T35486 |
Target Name | NRAS |
Gene ID | 4893, 18176, 709089, 24605, 751105, 403872, 506322, 100059469 |
Gene Symbol and Synonyms | ALPS4,CMNS,KRAS,N-ras,NCMS,NRAS,NRAS1,NS6,rasp21 |
Uniprot Accession | P01111 |
Uniprot Entry Name | RASN_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Non-Small Cell Lung Cancer, Colorectal Cancer, Malignant neoplasm of bladder |
Gene Ensembl | ENSG00000213281 |
Target Classification | Not Available |
This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated by a guanine nucleotide-exchange factor and inactivated by a GTPase activating protein. Mutations in this gene have been associated with somatic rectal cancer, follicular thyroid cancer, autoimmune lymphoproliferative syndrome, Noonan syndrome, and juvenile myelomonocytic leukemia. [provided by RefSeq, Jun 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.