Human NRas/ALPS4/CMNS ORF/cDNA clone-Lentivirus particle (NM_002524.4)

Cat. No.: vGMLP-SPh-053

Pre-made Human NRas/ALPS4/CMNS Lentiviral expression plasmid for NRas lentivirus packaging, NRas lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NRAS/NRas/ALPS4 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP-SPh-053 Human NRas Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP-SPh-053
Gene Name NRas
Accession Number NM_002524.4
Gene ID 4893
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 570 bp
Gene Alias ALPS4,CMNS,N-ras,NCMS,NRAS1,NS6
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTGAGTACAAACTGGTGGTGGTTGGAGCAGGTGGTGTTGGGAAAAGCGCACTGACAATCCAGCTAATCCAGAACCACTTTGTAGATGAATATGATCCCACCATAGAGGATTCTTACAGAAAACAAGTGGTTATAGATGGTGAAACCTGTTTGTTGGACATACTGGATACAGCTGGACAAGAAGAGTACAGTGCCATGAGAGACCAATACATGAGGACAGGCGAAGGCTTCCTCTGTGTATTTGCCATCAATAATAGCAAGTCATTTGCGGATATTAACCTCTACAGGGAGCAGATTAAGCGAGTAAAAGACTCGGATGATGTACCTATGGTGCTAGTGGGAAACAAGTGTGATTTGCCAACAAGGACAGTTGATACAAAACAAGCCCACGAACTGGCCAAGAGTTACGGGATTCCATTCATTGAAACCTCAGCCAAGACCAGACAGGGTGTTGAAGATGCTTTTTACACACTGGTAAGAGAAATACGCCAGTACCGAATGAAAAAACTCAACAGCAGTGATGATGGGACTCAGGGTTGTATGGGATTGCCATGTGTGGTGATGTAA
ORF Protein Sequence MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T35486-Ab Anti-NRAS monoclonal antibody
    Target Antigen GM-Tg-g-T35486-Ag NRAS protein
    ORF Viral Vector pGMLP000874 Human NRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005597 Human NRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005783 Human NRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005784 Human NRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005785 Human NRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005786 Human NRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005787 Human NRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005788 Human NRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005789 Human NRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005790 Human NRAS Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-053 Human NRas Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-193 Human NRas Adenovirus plasmid
    ORF Viral Vector vGMLP000874 Human NRAS Lentivirus particle
    ORF Viral Vector vGMLP005597 Human NRAS Lentivirus particle
    ORF Viral Vector vGMLP005783 Human NRAS Lentivirus particle
    ORF Viral Vector vGMLP005784 Human NRAS Lentivirus particle
    ORF Viral Vector vGMLP005785 Human NRAS Lentivirus particle
    ORF Viral Vector vGMLP005786 Human NRAS Lentivirus particle
    ORF Viral Vector vGMLP005787 Human NRAS Lentivirus particle
    ORF Viral Vector vGMLP005788 Human NRAS Lentivirus particle
    ORF Viral Vector vGMLP005789 Human NRAS Lentivirus particle
    ORF Viral Vector vGMLP005790 Human NRAS Lentivirus particle
    ORF Viral Vector vGMLP-SPh-053 Human NRas Lentivirus particle
    ORF Viral Vector vGMAP-SPh-193 Human NRas Adenovirus particle


    Target information

    Target ID GM-T35486
    Target Name NRAS
    Gene ID 4893, 18176, 709089, 24605, 751105, 403872, 506322, 100059469
    Gene Symbol and Synonyms ALPS4,CMNS,KRAS,N-ras,NCMS,NRAS,NRAS1,NS6,rasp21
    Uniprot Accession P01111
    Uniprot Entry Name RASN_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Non-Small Cell Lung Cancer, Colorectal Cancer, Malignant neoplasm of bladder
    Gene Ensembl ENSG00000213281
    Target Classification Not Available

    This is an N-ras oncogene encoding a membrane protein that shuttles between the Golgi apparatus and the plasma membrane. This shuttling is regulated through palmitoylation and depalmitoylation by the ZDHHC9-GOLGA7 complex. The encoded protein, which has intrinsic GTPase activity, is activated by a guanine nucleotide-exchange factor and inactivated by a GTPase activating protein. Mutations in this gene have been associated with somatic rectal cancer, follicular thyroid cancer, autoimmune lymphoproliferative syndrome, Noonan syndrome, and juvenile myelomonocytic leukemia. [provided by RefSeq, Jun 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.