Human DIABLO/DFNA64/SMAC ORF/cDNA clone-Lentivirus plasmid (NM_019887)
Cat. No.: pGMLV000088
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human DIABLO/DFNA64/SMAC Lentiviral expression plasmid for DIABLO lentivirus packaging, DIABLO lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
DIABLO/DFNA64 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV000088 |
| Gene Name | DIABLO |
| Accession Number | NM_019887 |
| Gene ID | 56616 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 720 bp |
| Gene Alias | DFNA64,SMAC |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGCTCTGAAGAGTTGGCTGTCGCGCAGCGTAACTTCATTCTTCAGGTACAGACAGTGTTTGTGTGTTCCTGTTGTGGCTAACTTTAAGAAGCGGTGTTTCTCAGAATTGATAAGACCATGGCACAAAACTGTGACGATTGGCTTTGGAGTAACCCTGTGTGCGGTTCCTATTGCACAGAAATCAGAGCCTCATTCCCTTAGTAGTGAAGCATTGATGAGGAGAGCAGTGTCTTTGGTAACAGATAGCACCTCTACCTTTCTCTCTCAGACCACATATGCGTTGATTGAAGCTATTACTGAATATACTAAGGCTGTTTATACCTTAACTTCTCTTTACCGACAATATACAAGTTTACTTGGGAAAATGAATTCAGAGGAGGAAGATGAAGTGTGGCAGGTGATCATAGGAGCCAGAGCTGAGATGACTTCAAAACACCAAGAGTACTTGAAGCTGGAAACCACTTGGATGACTGCAGTTGGTCTTTCAGAGATGGCAGCAGAAGCTGCATATCAAACTGGCGCAGATCAGGCCTCTATAACCGCCAGGAATCACATTCAGCTGGTGAAACTGCAGGTGGAAGAGGTGCACCAGCTCTCCCGGAAAGCAGAAACCAAGCTGGCAGAAGCACAGATAGAAGAGCTCCGTCAGAAAACACAGGAGGAAGGGGAGGAGCGGGCTGAGTCGGAGCAGGAGGCCTACCTGCGTGAGGATTGA |
| ORF Protein Sequence | MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IP0216-Ab | Anti-DIABLO monoclonal antibody |
| Target Antigen | GM-Tg-g-IP0216-Ag | DIABLO protein |
| ORF Viral Vector | pGMLV000088 | Human DIABLO Lentivirus plasmid |
| ORF Viral Vector | vGMLV000088 | Human DIABLO Lentivirus particle |
Target information
| Target ID | GM-IP0216 |
| Target Name | DIABLO |
| Gene ID | 56616, 66593, 701896, 288753, 768282, 477463, 493999, 100058709 |
| Gene Symbol and Synonyms | 0610041G12Rik,1700006L01Rik,DBO,DFNA64,DIABLO,SMAC |
| Uniprot Accession | Q9NR28 |
| Uniprot Entry Name | DBLOH_HUMAN |
| Protein Sub-location | Introcelluar Protein |
| Category | Not Available |
| Disease | Cancer |
| Gene Ensembl | ENSG00000184047 |
| Target Classification | Tumor-associated antigen (TAA) |
This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


