Human DIABLO/DFNA64/SMAC ORF/cDNA clone-Lentivirus particle (NM_019887)

Cat. No.: vGMLV000088

Pre-made Human DIABLO/DFNA64/SMAC Lentiviral expression plasmid for DIABLO lentivirus packaging, DIABLO lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to DIABLO/DFNA64 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV000088 Human DIABLO Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV000088
Gene Name DIABLO
Accession Number NM_019887
Gene ID 56616
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 720 bp
Gene Alias DFNA64,SMAC
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCTCTGAAGAGTTGGCTGTCGCGCAGCGTAACTTCATTCTTCAGGTACAGACAGTGTTTGTGTGTTCCTGTTGTGGCTAACTTTAAGAAGCGGTGTTTCTCAGAATTGATAAGACCATGGCACAAAACTGTGACGATTGGCTTTGGAGTAACCCTGTGTGCGGTTCCTATTGCACAGAAATCAGAGCCTCATTCCCTTAGTAGTGAAGCATTGATGAGGAGAGCAGTGTCTTTGGTAACAGATAGCACCTCTACCTTTCTCTCTCAGACCACATATGCGTTGATTGAAGCTATTACTGAATATACTAAGGCTGTTTATACCTTAACTTCTCTTTACCGACAATATACAAGTTTACTTGGGAAAATGAATTCAGAGGAGGAAGATGAAGTGTGGCAGGTGATCATAGGAGCCAGAGCTGAGATGACTTCAAAACACCAAGAGTACTTGAAGCTGGAAACCACTTGGATGACTGCAGTTGGTCTTTCAGAGATGGCAGCAGAAGCTGCATATCAAACTGGCGCAGATCAGGCCTCTATAACCGCCAGGAATCACATTCAGCTGGTGAAACTGCAGGTGGAAGAGGTGCACCAGCTCTCCCGGAAAGCAGAAACCAAGCTGGCAGAAGCACAGATAGAAGAGCTCCGTCAGAAAACACAGGAGGAAGGGGAGGAGCGGGCTGAGTCGGAGCAGGAGGCCTACCTGCGTGAGGATTGA
ORF Protein Sequence MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0216-Ab Anti-DIABLO monoclonal antibody
    Target Antigen GM-Tg-g-IP0216-Ag DIABLO protein
    ORF Viral Vector pGMLV000088 Human DIABLO Lentivirus plasmid
    ORF Viral Vector vGMLV000088 Human DIABLO Lentivirus particle


    Target information

    Target ID GM-IP0216
    Target Name DIABLO
    Gene ID 56616, 66593, 701896, 288753, 768282, 477463, 493999, 100058709
    Gene Symbol and Synonyms 0610041G12Rik,1700006L01Rik,DBO,DFNA64,DIABLO,SMAC
    Uniprot Accession Q9NR28
    Uniprot Entry Name DBLOH_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000184047
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.