Human TNFSF9/4-1BB-L/CD137L ORF/cDNA clone-Lentivirus plasmid (NM_003811.3)
                                                               Cat. No.: pGMLV000252
 
                                                               
                                                               Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human TNFSF9/4-1BB-L/CD137L Lentiviral expression plasmid for TNFSF9 lentivirus packaging, TNFSF9 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
                                                                            4-1BBL/TNFSF9/4-1BB-L products
                                                                            collection>>
(antibodies,
                                                                            antigen, VLP, mRNA, ORF viral vector, etc)
                                                                        
                                                                    
Product Description
| Catalog ID | pGMLV000252 | 
| Gene Name | TNFSF9 | 
| Accession Number | NM_003811.3 | 
| Gene ID | 8744 | 
| Species | Human | 
| Product Type | Lentivirus plasmid (overexpression) | 
| Insert Length | 765 bp | 
| Gene Alias | 4-1BB-L,CD137L,TNLG5A | 
| Fluorescent Reporter | ZsGreen | 
| Mammalian Cell Selection | Puromyocin | 
| Fusion Tag | 3xflag (C-Terminal) | 
| Promoter | CMV | 
| Resistance | Amplicin | 
| ORF Nucleotide Sequence | ATGGAATACGCCTCTGACGCTTCACTGGACCCCGAAGCCCCGTGGCCTCCCGCGCCCCGCGCTCGCGCCTGCCGCGTACTGCCTTGGGCCCTGGTCGCGGGGCTGCTGCTGCTGCTGCTGCTCGCTGCCGCCTGCGCCGTCTTCCTCGCCTGCCCCTGGGCCGTGTCCGGGGCTCGCGCCTCGCCCGGCTCCGCGGCCAGCCCGAGACTCCGCGAGGGTCCCGAGCTTTCGCCCGACGATCCCGCCGGCCTCTTGGACCTGCGGCAGGGCATGTTTGCGCAGCTGGTGGCCCAAAATGTTCTGCTGATCGATGGGCCCCTGAGCTGGTACAGTGACCCAGGCCTGGCAGGCGTGTCCCTGACGGGGGGCCTGAGCTACAAAGAGGACACGAAGGAGCTGGTGGTGGCCAAGGCTGGAGTCTACTATGTCTTCTTTCAACTAGAGCTGCGGCGCGTGGTGGCCGGCGAGGGCTCAGGCTCCGTTTCACTTGCGCTGCACCTGCAGCCACTGCGCTCTGCTGCTGGGGCCGCCGCCCTGGCTTTGACCGTGGACCTGCCACCCGCCTCCTCCGAGGCTCGGAACTCGGCCTTCGGTTTCCAGGGCCGCTTGCTGCACCTGAGTGCCGGCCAGCGCCTGGGCGTCCATCTTCACACTGAGGCCAGGGCACGCCATGCCTGGCAGCTTACCCAGGGCGCCACAGTCTTGGGACTCTTCCGGGTGACCCCCGAAATCCCAGCCGGACTCCCTTCACCGAGGTCGGAATAA | 
| ORF Protein Sequence | MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE | 
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name | 
|---|---|---|
| Target Antibody | GM-Tg-g-IO001-Ab | Anti-TNFL9/ 4-1BBL/ TNFSF9 monoclonal antibody | 
| Target Antigen | GM-Tg-g-IO001-Ag | 4-1BBL/TNFSF9 VLP (virus-like particle) | 
| Cytokine | cks-Tg-g-GM-IO001 | tumor necrosis factor (ligand) superfamily, member 9 (TNFSF9) protein & antibody | 
| ORF Viral Vector | pGMLV000252 | Human TNFSF9 Lentivirus plasmid | 
| ORF Viral Vector | vGMLV000252 | Human TNFSF9 Lentivirus particle | 
Target information
| Target ID | GM-IO001 | 
| Target Name | 4-1BBL | 
| Gene ID | 8744, 21950, 700588, 353218, 101087207, 476729, 521748, 102150292 | 
| Gene Symbol and Synonyms | 4-1BB-L,4-1BBL,CD137L,Ly63l,TNFSF9,TNLG5A | 
| Uniprot Accession | P41273 | 
| Uniprot Entry Name | TNFL9_HUMAN | 
| Protein Sub-location | Transmembrane Protein | 
| Category | Therapeutics Target, Immuno-oncology Target, Cytokine Target | 
| Disease | Not Available | 
| Gene Ensembl | ENSG00000125657 | 
| Target Classification | Checkpoint-Immuno Oncology | 
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.[provided by RefSeq, Oct 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.
                
                
            
        
        
                                                            

