Human DERL3/C22orf14/derlin-3 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001135751.1)

Cat. No.: pGMPC000053
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human DERL3/C22orf14/derlin-3 Non-Viral expression plasmid (overexpression vector) for mouse DERL3 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to DERL3/C22orf14 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000053
Gene Name DERL3
Accession Number NM_001135751.1
Gene ID 91319
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 720 bp
Gene Alias C22orf14,derlin-3,IZP6,LLN2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGTGGCAGGGACTAGCGGCCGAGTTCCTGCAGGTGCCGGCGGTGACGCGGGCTTACACCGCAGCCTGTGTCCTCACCACCGCCGCGGTGCAGCTGGAGCTCCTCAGCCCCTTTCAACTCTACTTCAACCCGCACCTTGTGTTCCGGAAGTTCCAGGTCTGGAGGCTCGTCACCAACTTCCTCTTCTTCGGGCCCCTGGGATTCAGCTTCTTCTTCAACATGCTCTTCGTGTTCCGCTACTGCCGCATGCTGGAAGAGGGCTCCTTCCGCGGCCGCACGGCCGACTTCGTCTTCATGTTTCTCTTCGGGGGCGTCCTTATGACCCTGCTGGGACTCCTGGGCAGCCTGTTCTTCCTGGGCCAGGCCCTCATGGCCATGCTGGTGTACGTGTGGAGCCGCCGCAGCCCTCGGGTGAGGGTCAACTTCTTCGGCCTGCTCACTTTCCAGGCACCGTTCCTGCCTTGGGCGCTCATGGGCTTCTCGCTGCTGCTGGGCAACTCCATCCTCGTGGACCTGCTGGGGATTGCGGTGGGCCATATCTACTACTTCCTGGAGGACGTCTTCCCCAACCAGCCTGGAGGCAAGAGGCTCCTGCAGACCCCTGGCTTCCTGGGACTTCAGAGCAGCAAGGCCCCAGCTGGCAGTAGCCTGACCATCTGGACACAGCAGAGCCAGGGCGGCCCAGGGACGGCAGGAGAGCTCGCGGCACCTTCCTGA
ORF Protein Sequence MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFLGQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVFPNQPGGKRLLQTPGFLGLQSSKAPAGSSLTIWTQQSQGGPGTAGELAAPS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0685-Ab Anti-DERL3 monoclonal antibody
    Target Antigen GM-Tg-g-IP0685-Ag DERL3 protein
    ORF Viral Vector pGMPC000053 Human DERL3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000800 Human DERL3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001121 Human DERL3 Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-IP0685
    Target Name DERL3
    Gene ID 91319, 70377, 699316, 690315, 101089806, 486406, 614334
    Gene Symbol and Synonyms 1810006I20Rik,1810063P04Rik,C22orf14,DERL3,derlin-3,IZP6,LLN2
    Uniprot Accession Q96Q80
    Uniprot Entry Name DERL3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000099958
    Target Classification Not Available

    The protein encoded by this gene belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.