Human DERL3/C22orf14/derlin-3 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001135751.1)
Cat. No.: pGMPC001121
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human DERL3/C22orf14/derlin-3 Non-Viral expression plasmid (overexpression vector) for mouse DERL3 overexpression in unique cell transient transfection and stable cell line development.
Go to
DERL3/C22orf14 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC001121 |
Gene Name | DERL3 |
Accession Number | NM_001135751.1 |
Gene ID | 91319 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 720 bp |
Gene Alias | C22orf14,derlin-3,IZP6,LLN2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCGTGGCAGGGACTAGCGGCCGAGTTCCTGCAGGTGCCGGCGGTGACGCGGGCTTACACCGCAGCCTGTGTCCTCACCACCGCCGCGGTGCAGCTGGAGCTCCTCAGCCCCTTTCAACTCTACTTCAACCCGCACCTTGTGTTCCGGAAGTTCCAGGTCTGGAGGCTCGTCACCAACTTCCTCTTCTTCGGGCCCCTGGGATTCAGCTTCTTCTTCAACATGCTCTTCGTGTTCCGCTACTGCCGCATGCTGGAAGAGGGCTCCTTCCGCGGCCGCACGGCCGACTTCGTCTTCATGTTTCTCTTCGGGGGCGTCCTTATGACCCTGCTGGGACTCCTGGGCAGCCTGTTCTTCCTGGGCCAGGCCCTCATGGCCATGCTGGTGTACGTGTGGAGCCGCCGCAGCCCTCGGGTGAGGGTCAACTTCTTCGGCCTGCTCACTTTCCAGGCACCGTTCCTGCCTTGGGCGCTCATGGGCTTCTCGCTGCTGCTGGGCAACTCCATCCTCGTGGACCTGCTGGGGATTGCGGTGGGCCATATCTACTACTTCCTGGAGGACGTCTTCCCCAACCAGCCTGGAGGCAAGAGGCTCCTGCAGACCCCTGGCTTCCTGGGACTTCAGAGCAGCAAGGCCCCAGCTGGCAGTAGCCTGACCATCTGGACACAGCAGAGCCAGGGCGGCCCAGGGACGGCAGGAGAGCTCGCGGCACCTTCCTGA |
ORF Protein Sequence | MAWQGLAAEFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLVTNFLFFGPLGFSFFFNMLFVFRYCRMLEEGSFRGRTADFVFMFLFGGVLMTLLGLLGSLFFLGQALMAMLVYVWSRRSPRVRVNFFGLLTFQAPFLPWALMGFSLLLGNSILVDLLGIAVGHIYYFLEDVFPNQPGGKRLLQTPGFLGLQSSKAPAGSSLTIWTQQSQGGPGTAGELAAPS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0685-Ab | Anti-DERL3 monoclonal antibody |
Target Antigen | GM-Tg-g-IP0685-Ag | DERL3 protein |
ORF Viral Vector | pGMPC000053 | Human DERL3 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC000800 | Human DERL3 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001121 | Human DERL3 Mammalian (Non-Viral Vector) plasmid |
Target information
Target ID | GM-IP0685 |
Target Name | DERL3 |
Gene ID | 91319, 70377, 699316, 690315, 101089806, 486406, 614334 |
Gene Symbol and Synonyms | 1810006I20Rik,1810063P04Rik,C22orf14,DERL3,derlin-3,IZP6,LLN2 |
Uniprot Accession | Q96Q80 |
Uniprot Entry Name | DERL3_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000099958 |
Target Classification | Not Available |
The protein encoded by this gene belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Oct 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.