Human CCL14/CC-1/CC-3 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_032963.4)

Cat. No.: pGMPC000173
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CCL14/CC-1/CC-3 Non-Viral expression plasmid (overexpression vector) for mouse CCL14 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CCL14/CC-1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000173
Gene Name CCL14
Accession Number NM_032963.4
Gene ID 6358
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 282 bp
Gene Alias CC-1,CC-3,CKB1,HCC-1,HCC-1(1-74),HCC-1/HCC-3,HCC-3,MCIF,NCC-2,NCC2,SCYA14,SCYL2,SY14
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGATCTCCGTGGCTGCCATTCCCTTCTTCCTCCTCATCACCATCGCCCTAGGGACCAAGACTGAATCCTCCTCACGGGGACCTTACCACCCCTCAGAGTGCTGCTTCACCTACACTACCTACAAGATCCCGCGTCAGCGGATTATGGATTACTATGAGACCAACAGCCAGTGCTCCAAGCCCGGAATTGTCTTCATCACCAAAAGGGGCCATTCCGTCTGTACCAACCCCAGTGACAAGTGGGTCCAGGACTATATCAAGGACATGAAGGAGAACTGA
ORF Protein Sequence MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0740-Ab Anti-CCL14/ CC-1/ CC-3 functional antibody
    Target Antigen GM-Tg-g-SE0740-Ag CCL14 protein
    Cytokine cks-Tg-g-GM-SE0740 chemokine (C-C motif) ligand 14 (CCL14) protein & antibody
    ORF Viral Vector pGMLV001557 Human CCL14 Lentivirus plasmid
    ORF Viral Vector pGMAAV001201 Human CCL14 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMPC000173 Human CCL14 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV001557 Human CCL14 Lentivirus particle
    ORF Viral Vector vGMAAV001201 Human CCL14 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-SE0740
    Target Name CCL14
    Gene ID 6358, 716765
    Gene Symbol and Synonyms CC-1,CC-3,CCL14,CKB1,HCC-1,HCC-1(1-74),HCC-1/HCC-3,HCC-3,MCIF,NCC-2,NCC2,SCYA14,SCYL2,SY14
    Uniprot Accession Q16627
    Uniprot Entry Name CCL14_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Cytokine Target
    Disease Not Available
    Gene Ensembl ENSG00000276409
    Target Classification Not Available

    This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.