Human CMTM7/CKLFSF7 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_138410.4)

Cat. No.: pGMPC000235
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CMTM7/CKLFSF7 Non-Viral expression plasmid (overexpression vector) for mouse CMTM7 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to CMTM7/CKLFSF7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000235
Gene Name CMTM7
Accession Number NM_138410.4
Gene ID 112616
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 528 bp
Gene Alias CKLFSF7
Fluorescent Reporter YFP(YNE)
Mammalian Cell Selection Null
Fusion Tag MYC (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGCACGGAGCCGGGCTCGTCCGCACCACGTGCAGCAGCGGCAGCGCGCTCGGACCCGGGGCCGGCGCGGCCCAGCCCAGCGCGAGCCCCTTGGAGGGGCTGCTGGACCTCAGCTACCCCCGCACCCACGCGGCCCTGCTGAAAGTGGCGCAAATGGTCACCCTGCTGATTGCCTTCATCTGTGTGCGGAGCTCCCTGTGGACCAACTACAGCGCCTACAGCTACTTTGAAGTGGTCACCATTTGCGACTTGATAATGATCCTCGCCTTTTACCTGGTCCACCTCTTCCGCTTCTACCGCGTGCTCACCTGTATCAGCTGGCCCCTGTCGGAACTTCTGCACTATTTAATCGGTACCCTGCTCCTCCTCATCGCCTCCATTGTGGCAGCTTCCAAGAGTTACAACCAGAGCGGACTGGTAGCCGGAGCGATCTTTGGTTTCATGGCCACCTTCCTCTGCATGGCAAGCATATGGCTGTCCTATAAGATCTCGTGTGTAACCCAGTCCACAGATGCAGCCGTCTGA
ORF Protein Sequence MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0576-Ab Anti-CMTM7 monoclonal antibody
    Target Antigen GM-Tg-g-IP0576-Ag CMTM7 protein
    ORF Viral Vector pGMLP000348 Human CMTM7 Lentivirus plasmid
    ORF Viral Vector pGMPC000235 Human CMTM7 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000348 Human CMTM7 Lentivirus particle


    Target information

    Target ID GM-IP0576
    Target Name CMTM7
    Gene ID 112616, 102545, 704329, 501065, 101081246, 609722, 532269, 100056880
    Gene Symbol and Synonyms CKLFSF7,CMTM7,LNV
    Uniprot Accession Q96FZ5
    Uniprot Entry Name CKLF7_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000153551
    Target Classification Not Available

    This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.