Human CMTM7/CKLFSF7 ORF/cDNA clone-Lentivirus particle (NM_138410)

Cat. No.: vGMLP000348

Pre-made Human CMTM7/CKLFSF7 Lentiviral expression plasmid for CMTM7 lentivirus packaging, CMTM7 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to CMTM7/CKLFSF7 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP000348 Human CMTM7 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP000348
Gene Name CMTM7
Accession Number NM_138410
Gene ID 112616
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 528 bp
Gene Alias CKLFSF7
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCGCACGGAGCCGGGCTCGTCCGCACCACGTGCAGCAGCGGCAGCGCGCTCGGACCCGGGGCCGGCGCGGCCCAGCCCAGCGCGAGCCCCTTGGAGGGGCTGCTGGACCTCAGCTACCCCCGCACCCACGCGGCCCTGCTGAAAGTGGCGCAAATGGTCACCCTGCTGATTGCCTTCATCTGTGTGCGGAGCTCCCTGTGGACCAACTACAGCGCCTACAGCTACTTTGAAGTGGTCACCATTTGCGACTTGATAATGATCCTCGCCTTTTACCTGGTCCACCTCTTCCGCTTCTACCGCGTGCTCACCTGTATCAGCTGGCCCCTGTCGGAACTTCTGCACTATTTAATCGGTACCCTGCTCCTCCTCATCGCCTCCATTGTGGCAGCTTCCAAGAGTTACAACCAGAGCGGACTGGTAGCCGGAGCGATCTTTGGTTTCATGGCCACCTTCCTCTGCATGGCAAGCATATGGCTGTCCTATAAGATCTCGTGTGTAACCCAGTCCACAGATGCAGCCGTCTGA
ORF Protein Sequence MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0576-Ab Anti-CMTM7 monoclonal antibody
    Target Antigen GM-Tg-g-IP0576-Ag CMTM7 protein
    ORF Viral Vector pGMLP000348 Human CMTM7 Lentivirus plasmid
    ORF Viral Vector pGMPC000235 Human CMTM7 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000348 Human CMTM7 Lentivirus particle


    Target information

    Target ID GM-IP0576
    Target Name CMTM7
    Gene ID 112616, 102545, 704329, 501065, 101081246, 609722, 532269, 100056880
    Gene Symbol and Synonyms CKLFSF7,CMTM7,LNV
    Uniprot Accession Q96FZ5
    Uniprot Entry Name CKLF7_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000153551
    Target Classification Not Available

    This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.