Human NDUFA4L2/COXFA4L2/NUOMS ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_020142.3)

Cat. No.: pGMPC000388
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human NDUFA4L2/COXFA4L2/NUOMS Non-Viral expression plasmid (overexpression vector) for mouse NDUFA4L2 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to NDUFA4L2/COXFA4L2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000388
Gene Name NDUFA4L2
Accession Number NM_020142.3
Gene ID 56901
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 264 bp
Gene Alias COXFA4L2,NUOMS
Fluorescent Reporter Firefly luciferase
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGGAGCCAGTCTTGGGGCCCGCTTCTACCGGCAGATCAAAAGACATCCGGGGATCATCCCGATGATCGGCTTAATCTGCCTGGGCATGGGCAGCGCTGCGCTTTACTTGCTGCGACTCGCCCTTCGCAGCCCCGACGTCTGCTGGGACAGAAAGAACAACCCGGAGCCCTGGAACCGCCTGAGCCCCAATGACCAATACAAGTTCCTTGCAGTTTCCACTGACTATAAGAAGCTGAAGAAGGACCGGCCAGACTTCTAA
ORF Protein Sequence MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1256-Ab Anti-NDUFA4L2 monoclonal antibody
    Target Antigen GM-Tg-g-IP1256-Ag NDUFA4L2 protein
    ORF Viral Vector pGMLP003186 Human NDUFA4L2 Lentivirus plasmid
    ORF Viral Vector pGMPC000388 Human NDUFA4L2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003186 Human NDUFA4L2 Lentivirus particle


    Target information

    Target ID GM-IP1256
    Target Name NDUFA4L2
    Gene ID 56901, 407790, 714483, 100362331, 101091711, 607407, 613541, 100052985
    Gene Symbol and Synonyms COXFA4L2,MISTRH,NDUFA4L2,NUOMS
    Uniprot Accession Q9NRX3
    Uniprot Entry Name NUA4L_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000185633
    Target Classification Not Available

    Predicted to be integral component of membrane. Predicted to be part of mitochondrial respiratory chain complex IV. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.