Human NDUFA4L2/NUOMS ORF/cDNA clone-Lentivirus particle (NM_020142)

Cat. No.: vGMLP003186

Pre-made Human NDUFA4L2/NUOMS Lentiviral expression plasmid for NDUFA4L2 lentivirus packaging, NDUFA4L2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NDUFA4L2/NUOMS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003186 Human NDUFA4L2 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003186
Gene Name NDUFA4L2
Accession Number NM_020142
Gene ID 56901
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 264 bp
Gene Alias NUOMS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCAGGAGCCAGTCTTGGGGCCCGCTTCTACCGGCAGATCAAAAGACATCCGGGGATCATCCCGATGATCGGCTTAATCTGCCTGGGCATGGGCAGCGCTGCGCTTTACTTGCTGCGACTCGCCCTTCGCAGCCCCGACGTCTGCTGGGACAGAAAGAACAACCCGGAGCCCTGGAACCGCCTGAGCCCCAATGACCAATACAAGTTCCTTGCAGTTTCCACTGACTATAAGAAGCTGAAGAAGGACCGGCCAGACTTCTAA
ORF Protein Sequence MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1256-Ab Anti-NDUFA4L2 monoclonal antibody
    Target Antigen GM-Tg-g-IP1256-Ag NDUFA4L2 protein
    ORF Viral Vector pGMLP003186 Human NDUFA4L2 Lentivirus plasmid
    ORF Viral Vector pGMPC000388 Human NDUFA4L2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP003186 Human NDUFA4L2 Lentivirus particle


    Target information

    Target ID GM-IP1256
    Target Name NDUFA4L2
    Gene ID 56901, 407790, 714483, 100362331, 101091711, 607407, 613541, 100052985
    Gene Symbol and Synonyms COXFA4L2,MISTRH,NDUFA4L2,NUOMS
    Uniprot Accession Q9NRX3
    Uniprot Entry Name NUA4L_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000185633
    Target Classification Not Available

    Predicted to be integral component of membrane. Predicted to be part of mitochondrial respiratory chain complex IV. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.