Human EPSTI1/BRESI1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001330543.2)

Cat. No.: pGMPC000598
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human EPSTI1/BRESI1 Non-Viral expression plasmid (overexpression vector) for mouse EPSTI1 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to EPSTI1/BRESI1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000598
Gene Name EPSTI1
Accession Number NM_001330543.2
Gene ID 94240
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 957 bp
Gene Alias BRESI1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Neomycin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACACCCGCAATAGAGTGGTGAACTCCGGGCTCGGCGCCTCCCCTGCCTCCCGCCCGACCCGGGATCCCCAGGACCCTTCTGGGCGGCAAGGGGAGCTGAGCCCCGTGGAAGACCAGAGAGAGGGTTTGGAGGCAGCCCCTAAGGGCCCTTCGCGGGAGAGCGTCGTGCACGCGGGCCAGAGGCGCACAAGTGCATACACCTTGATAGCACCAAATATAAACCGGAGAAATGAGATACAAAGAATTGCGGAGCAGGAGCTGGCCAACCTGGAGAAGTGGAAGGAGCAGAACAGAGCTAAACCGGTTCACCTGGTGCCCAGACGGCTAGGTGGAAGCCAGTCAGAAACTGAAGTCAGACAGAAACAACAACTCCAGCTGATGCAATCTAAATACAAGCAAAAGCTAAAAAGAGAAGAATCTGTAAGAATCAAGAAGGAAGCTGAAGAAGCTGAACTCCAAAAAATGAAGGCAATTCAGAGAGAGAAGAGCAATAAACTGGAGGAGAAAAAAAGACTTCAAGAAAACCTTAGAAGAGAAGCATTTAGAGAGCATCAGCAATACAAAACCGCTGAGTTCTTGAGCAAACTGAACACAGAATCGCCAGACAGAAGTGCCTGTCAAAGTGCTGTTTGTGGCCCACAATCCTCAACATGGAAACTTCCTATCCTGCCTAGGGATCACAGCTGGGCCAGAAGCTGGGCTTACAGAGATTCTCTAAAGGCAGAAGAAAACAGAAAATTGCAAAAGATGAAGGATGAACAACATCAAAAGAGTGAATTACTGGAACTGAAACGGCAGCAGCAAGAGCAAGAAAGAGCCAAAATCCACCAGACTGAACACAGGAGGGTAAATAATGCTTTTCTGGACCGACTCCAAGGCAAAAGTCAACCAGGTGGCCTCGAGCAATCTGGAGGCTGTTGGAATATGAATAGCGGTAACAGCTGGGGTATATGA
ORF Protein Sequence MNTRNRVVNSGLGASPASRPTRDPQDPSGRQGELSPVEDQREGLEAAPKGPSRESVVHAGQRRTSAYTLIAPNINRRNEIQRIAEQELANLEKWKEQNRAKPVHLVPRRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMKAIQREKSNKLEEKKRLQENLRREAFREHQQYKTAEFLSKLNTESPDRSACQSAVCGPQSSTWKLPILPRDHSWARSWAYRDSLKAEENRKLQKMKDEQHQKSELLELKRQQQEQERAKIHQTEHRRVNNAFLDRLQGKSQPGGLEQSGGCWNMNSGNSWGI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0763-Ab Anti-EPSTI1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0763-Ag EPSTI1 protein
    ORF Viral Vector pGMPC000598 Human EPSTI1 Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-IP0763
    Target Name EPSTI1
    Gene ID 94240, 108670, 700208, 498547, 101089570, 476931, 614555, 100051337
    Gene Symbol and Synonyms 2310046K10Rik,5033415K03Rik,BRESI1,EPSTI1,RGD1563207
    Uniprot Accession Q96J88
    Uniprot Entry Name ESIP1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Ovary Cancer
    Gene Ensembl ENSG00000133106
    Target Classification Not Available

    The protein encoded by this gene has been shown to promote tumor invasion and metastasis in some invasive cancer cells when overexpressed. Expression of this gene has been shown to be upregulated by direct binding of the Kruppel like factor 8 protein to promoter sequences. The translated protein interacts with the amino terminal region of the valosin containing protein gene product, resulting in the nuclear translocation of the nuclear factor kappa B subunit 1 gene product, and activation of target genes. Overexpression of this gene has been observed in some breast cancers and in some individuals with systemic lupus erythematosus (SLE). [provided by RefSeq, Sep 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.