Human TSPAN4/NAG-2/NAG2 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_003271.5)

Cat. No.: pGMPC000710
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TSPAN4/NAG-2/NAG2 Non-Viral expression plasmid (overexpression vector) for mouse TSPAN4 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to TSPAN4/NAG-2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000710
Gene Name TSPAN4
Accession Number NM_003271.5
Gene ID 7106
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 717 bp
Gene Alias NAG-2,NAG2,TETRASPAN,TM4SF7,TSPAN-4
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGCGCGCCTGCCTCCAGGCCGTCAAGTACCTCATGTTCGCCTTCAACCTGCTCTTCTGGCTGGGAGGCTGTGGCGTGCTGGGTGTCGGCATCTGGCTGGCCGCCACACAGGGGAGCTTCGCCACGCTGTCCTCTTCCTTCCCGTCCCTGTCGGCTGCCAACTTGCTCATCATCACCGGCGCCTTTGTCATGGCCATCGGCTTCGTGGGCTGCCTGGGTGCCATCAAGGAGAACAAGTGCCTCCTGCTCACTTTCTTCCTGCTGCTGCTGCTGGTGTTCCTGCTGGAGGCCACCATCGCCATCCTCTTCTTCGCCTACACGGACAAGATTGACAGGTATGCCCAGCAAGACCTGAAGAAAGGCTTGCACCTGTACGGCACGCAGGGCAACGTGGGCCTCACCAACGCCTGGAGCATCATCCAGACCGACTTCCGCTGCTGTGGCGTCTCCAACTACACTGACTGGTTCGAGGTGTACAACGCCACGCGGGTACCTGACTCCTGCTGCTTGGAGTTCAGTGAGAGCTGTGGGCTGCACGCCCCCGGCACCTGGTGGAAGGCGCCGTGCTACGAGACGGTGAAGGTGTGGCTTCAGGAGAACCTGCTGGCTGTGGGCATCTTTGGGCTGTGCACGGCGCTGGTGCAGATCCTGGGCCTGACCTTCGCCATGACCATGTACTGCCAAGTGGTCAAGGCAGACACCTACTGCGCGTAG
ORF Protein Sequence MARACLQAVKYLMFAFNLLFWLGGCGVLGVGIWLAATQGSFATLSSSFPSLSAANLLIITGAFVMAIGFVGCLGAIKENKCLLLTFFLLLLLVFLLEATIAILFFAYTDKIDRYAQQDLKKGLHLYGTQGNVGLTNAWSIIQTDFRCCGVSNYTDWFEVYNATRVPDSCCLEFSESCGLHAPGTWWKAPCYETVKVWLQENLLAVGIFGLCTALVQILGLTFAMTMYCQVVKADTYCA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1885-Ab Anti-TSN4/ TSPAN4/ NAG-2 monoclonal antibody
    Target Antigen GM-Tg-g-MP1885-Ag TSPAN4 VLP (virus-like particle)
    ORF Viral Vector pGMLV002293 Human TSPAN4 Lentivirus plasmid
    ORF Viral Vector pGMAD001380 Human TSPAN4 Adenovirus plasmid
    ORF Viral Vector pGMPC000710 Human TSPAN4 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV002293 Human TSPAN4 Lentivirus particle
    ORF Viral Vector vGMAD001380 Human TSPAN4 Adenovirus particle


    Target information

    Target ID GM-MP1885
    Target Name TSPAN4
    Gene ID 7106, 64540, 707716, 293627, 101098088, 611422, 505288, 100055228
    Gene Symbol and Synonyms D130042I01Rik,NAG-2,NAG2,TETRASPAN,TM4SF7,TSPAN-4,TSPAN4
    Uniprot Accession O14817
    Uniprot Entry Name TSN4_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000214063
    Target Classification Not Available

    The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and is similar in sequence to its family member CD53 antigen. It is known to complex with integrins and other transmembrane 4 superfamily proteins. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.