Human RNF183 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_001371234.1)

Cat. No.: pGMPC000955
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human RNF183/ Non-Viral expression plasmid (overexpression vector) for mouse RNF183 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to RNF183/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000955
Gene Name RNF183
Accession Number NM_001371234.1
Gene ID 138065
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 579 bp
Gene Alias
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGAGCAGCAGGGCCGGGAGCTTGAGGCTGAGTGCCCCGTCTGCTGGAACCCCTTCAACAACACGTTCCATACCCCCAAAATGCTGGATTGCTGCCACTCCTTCTGCGTGGAATGTCTGGCCCACCTCAGCCTTGTGACTCCAGCCCGGCGCCGCCTGCTGTGCCCACTCTGTCGCCAGCCCACAGTGCTGGCCTCAGGGCAGCCTGTCACTGACTTGCCCACGGACACTGCCATGCTCGCCCTGCTCCGCCTGGAGCCCCACCATGTCATCCTGGAAGGCCATCAGCTGTGCCTCAAGGACCAGCCCAAGAGCCGCTACTTCCTGCGCCAGCCTCAAGTCTACACGCTGGACCTTGGCCCCCAGCCTGGGGGCCAGACTGGGCCGCCCCCAGACACGGCCTCTGCCACCGTGTCTACGCCCATCCTCATCCCCAGCCACCACTCTTTGAGGGAGTGTTTCCGCAACCCTCAGTTCCGCATCTTTGCCTACCTGATGGCCGTCATCCTCAGTGTCACTCTGTTGCTCATATTCTCCATCTTTTGGACCAAGCAGTTCCTTTGGGGTGTGGGGTGA
ORF Protein Sequence MAEQQGRELEAECPVCWNPFNNTFHTPKMLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQPVTDLPTDTAMLALLRLEPHHVILEGHQLCLKDQPKSRYFLRQPQVYTLDLGPQPGGQTGPPPDTASATVSTPILIPSHHSLRECFRNPQFRIFAYLMAVILSVTLLLIFSIFWTKQFLWGVG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1519-Ab Anti-RNF183 monoclonal antibody
    Target Antigen GM-Tg-g-IP1519-Ag RNF183 protein
    ORF Viral Vector pGMPC000955 Human RNF183 Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-IP1519
    Target Name RNF183
    Gene ID 138065, 76072, 705679, 500474, 101096179, 100684892, 539200, 100050237
    Gene Symbol and Synonyms 5830442J12Rik,RGD1564412,RNF183
    Uniprot Accession Q96D59
    Uniprot Entry Name RN183_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000165188
    Target Classification Not Available

    Enables ubiquitin protein ligase activity. Involved in positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway; protein ubiquitination; and response to endoplasmic reticulum stress. Located in endoplasmic reticulum. Is integral component of endoplasmic reticulum membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.