Human SRSF3/SFRS3/SRp20 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_003017)

Cat. No.: pGMPC000966
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SRSF3/SFRS3/SRp20 Non-Viral expression plasmid (overexpression vector) for mouse SRSF3 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to SRSF3/SFRS3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC000966
Gene Name SRSF3
Accession Number NM_003017
Gene ID 6428
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 495 bp
Gene Alias SFRS3,SRp20
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCATCGTGATTCCTGTCCATTGGACTGTAAGGTTTATGTAGGCAATCTTGGAAACAATGGCAACAAGACGGAATTGGAACGGGCTTTTGGCTACTATGGACCACTCCGAAGTGTGTGGGTTGCTAGAAACCCACCCGGCTTTGCTTTTGTTGAATTTGAAGATCCCCGAGATGCAGCTGATGCAGTCCGAGAGCTAGATGGAAGAACACTATGTGGCTGCCGTGTAAGAGTGGAACTGTCGAATGGTGAAAAAAGAAGTAGAAATCGTGGCCCACCTCCCTCTTGGGGTCGTCGCCCTCGAGATGATTATCGTAGGAGGAGTCCTCCACCTCGTCGCAGATCTCCAAGAAGGAGAAGCTTCTCTCGCAGCCGGAGCAGGTCCCTTTCTAGAGATAGGAGAAGAGAGAGATCGCTGTCTCGGGAGAGAAATCACAAGCCGTCCCGATCCTTCTCTAGGTCTCGTAGTCGATCTAGGTCAAATGAAAGGAAATAG
ORF Protein Sequence MHRDSCPLDCKVYVGNLGNNGNKTELERAFGYYGPLRSVWVARNPPGFAFVEFEDPRDAADAVRELDGRTLCGCRVRVELSNGEKRSRNRGPPPSWGRRPRDDYRRRSPPPRRRSPRRRSFSRSRSRSLSRDRRRERSLSRERNHKPSRSFSRSRSRSRSNERK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1820-Ab Anti-SRSF3 monoclonal antibody
    Target Antigen GM-Tg-g-IP1820-Ag SRSF3 protein
    ORF Viral Vector pGMLP000996 Human SRSF3 Lentivirus plasmid
    ORF Viral Vector pGMPC000966 Human SRSF3 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000996 Human SRSF3 Lentivirus particle


    Target information

    Target ID GM-IP1820
    Target Name SRSF3
    Gene ID 6428, 20383, 719123, 361814, 101081223, 403687, 540276, 100053744
    Gene Symbol and Synonyms SFRS3,SRp20,SRSF3,X16
    Uniprot Accession P84103
    Uniprot Entry Name SRSF3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000112081
    Target Classification Not Available

    The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two transcript variants, one protein-coding and the other non-coding, have been found for this gene. [provided by RefSeq, Sep 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.