Human PAFAH1B2/HEL-S-303 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_002572.4)

Cat. No.: pGMPC001137
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human PAFAH1B2/HEL-S-303 Non-Viral expression plasmid (overexpression vector) for mouse PAFAH1B2 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to PAFAH1B2/HEL-S-303 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001137
Gene Name PAFAH1B2
Accession Number NM_002572.4
Gene ID 5049
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 690 bp
Gene Alias HEL-S-303
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCCAAGGAGACTCAAACCCAGCAGCTATTCCGCATGCAGCAGAAGATATTCAAGGAGATGACCGATGGATGTCTCAGCACAACAGATTTGTTTTGGACTGTAAAGACAAAGAGCCTGATGTACTGTTCGTGGGAGACTCCATGGTGCAGTTAATGCAGCAATATGAGATATGGCGAGAGCTTTTTTCCCCACTTCATGCACTGAATTTTGGAATTGGGGGAGATACAACAAGACATGTTTTGTGGAGACTAAAGAATGGAGAACTGGAGAATATTAAGCCTAAGGTCATTGTTGTCTGGGTAGGAACAAATAACCACGAAAATACAGCAGAAGAAGTAGCAGGTGGGATCGAGGCCATTGTACAACTTATCAACACAAGGCAGCCACAGGCCAAAATCATTGTATTGGGTTTGTTACCTCGAGGTGAGAAACCCAATCCTTTGAGGCAAAAGAACGCCAAGGTGAACCAACTCCTCAAGGTTTCGCTGCCGAAGCTTGCCAACGTGCAGCTCCTGGATACCGACGGGGGTTTTGTGCACTCGGACGGTGCCATCTCCTGCCACGACATGTTTGATTTTCTGCATCTGACAGGAGGGGGCTATGCAAAGATCTGCAAACCCCTGCATGAACTGATCATGCAGTTGTTGGAGGAAACACCTGAGGAGAAACAAACCACCATTGCCTGA
ORF Protein Sequence MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMVQLMQQYEIWRELFSPLHALNFGIGGDTTRHVLWRLKNGELENIKPKVIVVWVGTNNHENTAEEVAGGIEAIVQLINTRQPQAKIIVLGLLPRGEKPNPLRQKNAKVNQLLKVSLPKLANVQLLDTDGGFVHSDGAISCHDMFDFLHLTGGGYAKICKPLHELIMQLLEETPEEKQTTIA

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2229-Ab Anti-PA1B2/ PAFAH1B2/ HEL-S-303 monoclonal antibody
    Target Antigen GM-Tg-g-MP2229-Ag PAFAH1B2 VLP (virus-like particle)
    ORF Viral Vector pGMLP002441 Human PAFAH1B2 Lentivirus plasmid
    ORF Viral Vector pGMPC001137 Human PAFAH1B2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002441 Human PAFAH1B2 Lentivirus particle


    Target information

    Target ID GM-MP2229
    Target Name PAFAH1B2
    Gene ID 5049, 18475, 703013, 64189, 101085656, 119881476, 282514, 100062620
    Gene Symbol and Synonyms 2610005M20Rik,HEL-S-303,mus[b],PAFAH1B2,PAFAH1B2P68402,Pafahb
    Uniprot Accession P68402
    Uniprot Entry Name PA1B2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000168092
    Target Classification Tumor-associated antigen (TAA)

    Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Jan 2014]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.