Human SEC61G/SSS1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM-001012456.1)

Cat. No.: pGMPC001324
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SEC61G/SSS1 Non-Viral expression plasmid (overexpression vector) for mouse SEC61G overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to SEC61G/SSS1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001324
Gene Name SEC61G
Accession Number NM-001012456.1
Gene ID 23480
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 207 bp
Gene Alias SSS1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGATCAGGTAATGCAGTTTGTTGAGCCAAGTCGGCAGTTTGTAAAGGACTCCATTCGGCTGGTTAAAAGATGCACTAAACCTGATAGAAAAGAATTCCAGAAGATTGCCATGGCAACAGCAATAGGATTTGCTATAATGGGATTCATTGGCTTCTTTGTGAAATTGATCCATATTCCTATTAATAACATCATTGTTGGTGGCTGA
ORF Protein Sequence MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1600-Ab Anti-SEC61G monoclonal antibody
    Target Antigen GM-Tg-g-IP1600-Ag SEC61G protein
    ORF Viral Vector pGMLV000841 Human SEC61G Lentivirus plasmid
    ORF Viral Vector pGMLV001309 Human SEC61G Lentivirus plasmid
    ORF Viral Vector pGMPC001324 Human SEC61G Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000841 Human SEC61G Lentivirus particle
    ORF Viral Vector vGMLV001309 Human SEC61G Lentivirus particle


    Target information

    Target ID GM-IP1600
    Target Name SEC61G
    Gene ID 23480, 20335, 716898, 689134, 101084431, 404017, 615778, 100629979
    Gene Symbol and Synonyms SEC61G,SSS1
    Uniprot Accession P60059
    Uniprot Entry Name SC61G_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000132432
    Target Classification Not Available

    The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the gamma-subunit protein. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.