Human SEC61G/SSS1 ORF/cDNA clone-Lentivirus plasmid (NM_001012456.1)
Cat. No.: pGMLV001309
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human SEC61G/SSS1 Lentiviral expression plasmid for SEC61G lentivirus packaging, SEC61G lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
SEC61G/SSS1 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV001309 |
Gene Name | SEC61G |
Accession Number | NM_001012456.1 |
Gene ID | 23480 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 207 bp |
Gene Alias | SSS1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGATCAGGTAATGCAGTTTGTTGAGCCAAGTCGGCAGTTTGTAAAGGACTCCATTCGGCTGGTTAAAAGATGCACTAAACCTGATAGAAAAGAATTCCAGAAGATTGCCATGGCAACAGCAATAGGATTTGCTATAATGGGATTCATTGGCTTCTTTGTGAAATTGATCCATATTCCTATTAATAACATCATTGTTGGTGGCTGA |
ORF Protein Sequence | MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP1600-Ab | Anti-SEC61G monoclonal antibody |
Target Antigen | GM-Tg-g-IP1600-Ag | SEC61G protein |
ORF Viral Vector | pGMLV000841 | Human SEC61G Lentivirus plasmid |
ORF Viral Vector | pGMLV001309 | Human SEC61G Lentivirus plasmid |
ORF Viral Vector | pGMPC001324 | Human SEC61G Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLV000841 | Human SEC61G Lentivirus particle |
ORF Viral Vector | vGMLV001309 | Human SEC61G Lentivirus particle |
Target information
Target ID | GM-IP1600 |
Target Name | SEC61G |
Gene ID | 23480, 20335, 716898, 689134, 101084431, 404017, 615778, 100629979 |
Gene Symbol and Synonyms | SEC61G,SSS1 |
Uniprot Accession | P60059 |
Uniprot Entry Name | SC61G_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000132432 |
Target Classification | Not Available |
The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. Oligomers of the Sec61 complex form a transmembrane channel where proteins are translocated across and integrated into the ER membrane. This complex consists of three membrane proteins- alpha, beta, and gamma. This gene encodes the gamma-subunit protein. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.