Human HMGA1/HMG-R/HMGA1A ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_145899.3)

Cat. No.: pGMPC001453
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human HMGA1/HMG-R/HMGA1A Non-Viral expression plasmid (overexpression vector) for mouse HMGA1 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to HMGA1/HMG-R products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001453
Gene Name HMGA1
Accession Number NM_145899.3
Gene ID 3159
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 324 bp
Gene Alias HMG-R,HMGA1A,HMGIY
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAGTGAGTCGAGCTCGAAGTCCAGCCAGCCCTTGGCCTCCAAGCAGGAAAAGGACGGCACTGAGAAGCGGGGCCGGGGCAGGCCGCGCAAGCAGCCTCCGGTGAGTCCCGGGACAGCGCTGGTAGGGAGTCAGAAGGAGCCCAGCGAAGTGCCAACACCTAAGAGACCTCGGGGCCGACCAAAGGGAAGCAAAAACAAGGGTGCTGCCAAGACCCGGAAAACCACCACAACTCCAGGAAGGAAACCAAGGGGCAGACCCAAAAAACTGGAGAAGGAGGAAGAGGAGGGCATCTCGCAGGAGTCCTCGGAGGAGGAGCAGTGA
ORF Protein Sequence MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQESSEEEQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T68211-Ab Anti-HMGA1 monoclonal antibody
    Target Antigen GM-Tg-g-T68211-Ag HMGA1 protein
    ORF Viral Vector pGMLP000820 Human HMGA1 Lentivirus plasmid
    ORF Viral Vector pGMPC001448 Human HMGA1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001453 Human HMGA1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000820 Human HMGA1 Lentivirus particle


    Target information

    Target ID GM-T68211
    Target Name HMGA1
    Gene ID 3159, 15361, 718536, 117062, 101094850, 442946, 618849, 100629238
    Gene Symbol and Synonyms HMG-R,HMGA1,HMGA1A,Hmga1b,Hmgi,HMGIY,Hmgy
    Uniprot Accession P17096
    Uniprot Entry Name HMGA1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000137309
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.