Human CLEC5A/CLECSF5/MDL-1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_013252.3)
Cat. No.: pGMPC001513
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CLEC5A/CLECSF5/MDL-1 Non-Viral expression plasmid (overexpression vector) for mouse CLEC5A overexpression in unique cell transient transfection and stable cell line development.
Go to
CLEC5A/CLECSF5 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC001513 |
Gene Name | CLEC5A |
Accession Number | NM_013252.3 |
Gene ID | 23601 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 567 bp |
Gene Alias | CLECSF5,MDL-1,MDL1 |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAACTGGCACATGATCATCTCTGGGCTTATTGTGGTAGTGCTTAAAGTTGTTGGAATGACCTTATTTCTACTTTATTTCCCACAGATTTTTAACAAAAGTAACGATGGTTTCACCACCACCAGGAGCTATGGAACAGTCTCACAGATTTTTGGGAGCAGTTCCCCAAGTCCCAACGGCTTCATTACCACAAGGAGCTATGGAACAGTCTGCCCCAAAGACTGGGAATTTTATCAAGCAAGATGTTTTTTCTTATCCACTTCTGAATCATCTTGGAATGAAAGCAGGGACTTTTGCAAAGGAAAAGGATCCACATTGGCAATTGTCAACACGCCAGAGAAACTGAAGTTTCTTCAGGACATAACTGATGCTGAGAAGTATTTTATTGGCTTAATTTACCATCGTGAAGAGAAAAGGTGGCGTTGGATCAACAACTCTGTGTTCAATGGCAATGTTACCAATCAGAATCAGAATTTCAACTGTGCGACCATTGGCCTAACAAAGACATTTGATGCTGCATCATGTGACATCAGCTACCGCAGGATCTGTGAGAAGAATGCCAAATGA |
ORF Protein Sequence | MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0300-Ab | Anti-CLC5A/ CLEC5A/ CLECSF5 monoclonal antibody |
Target Antigen | GM-Tg-g-MP0300-Ag | CLEC5A VLP (virus-like particle) |
ORF Viral Vector | pGMPC001513 | Human CLEC5A Mammalian (Non-Viral Vector) plasmid |
Target information
Target ID | GM-MP0300 |
Target Name | CLEC5A |
Gene ID | 23601, 23845, 695425, 679787, 101084436, 609161, 615201, 100065358 |
Gene Symbol and Synonyms | CLEC5A,CLECSF5,Ly100,MDL-1,MDL1 |
Uniprot Accession | Q9NY25 |
Uniprot Entry Name | CLC5A_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000258227 |
Target Classification | Not Available |
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.