Human CLEC5A/CLECSF5/MDL-1 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_013252.3)

Cat. No.: pGMPC001513
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CLEC5A/CLECSF5/MDL-1 Non-Viral expression plasmid (overexpression vector) for mouse CLEC5A overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CLEC5A/CLECSF5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001513
Gene Name CLEC5A
Accession Number NM_013252.3
Gene ID 23601
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 567 bp
Gene Alias CLECSF5,MDL-1,MDL1
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGAACTGGCACATGATCATCTCTGGGCTTATTGTGGTAGTGCTTAAAGTTGTTGGAATGACCTTATTTCTACTTTATTTCCCACAGATTTTTAACAAAAGTAACGATGGTTTCACCACCACCAGGAGCTATGGAACAGTCTCACAGATTTTTGGGAGCAGTTCCCCAAGTCCCAACGGCTTCATTACCACAAGGAGCTATGGAACAGTCTGCCCCAAAGACTGGGAATTTTATCAAGCAAGATGTTTTTTCTTATCCACTTCTGAATCATCTTGGAATGAAAGCAGGGACTTTTGCAAAGGAAAAGGATCCACATTGGCAATTGTCAACACGCCAGAGAAACTGAAGTTTCTTCAGGACATAACTGATGCTGAGAAGTATTTTATTGGCTTAATTTACCATCGTGAAGAGAAAAGGTGGCGTTGGATCAACAACTCTGTGTTCAATGGCAATGTTACCAATCAGAATCAGAATTTCAACTGTGCGACCATTGGCCTAACAAAGACATTTGATGCTGCATCATGTGACATCAGCTACCGCAGGATCTGTGAGAAGAATGCCAAATGA
ORF Protein Sequence MNWHMIISGLIVVVLKVVGMTLFLLYFPQIFNKSNDGFTTTRSYGTVSQIFGSSSPSPNGFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDAEKYFIGLIYHREEKRWRWINNSVFNGNVTNQNQNFNCATIGLTKTFDAASCDISYRRICEKNAK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0300-Ab Anti-CLC5A/ CLEC5A/ CLECSF5 monoclonal antibody
    Target Antigen GM-Tg-g-MP0300-Ag CLEC5A VLP (virus-like particle)
    ORF Viral Vector pGMPC001513 Human CLEC5A Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-MP0300
    Target Name CLEC5A
    Gene ID 23601, 23845, 695425, 679787, 101084436, 609161, 615201, 100065358
    Gene Symbol and Synonyms CLEC5A,CLECSF5,Ly100,MDL-1,MDL1
    Uniprot Accession Q9NY25
    Uniprot Entry Name CLC5A_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000258227
    Target Classification Not Available

    This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The encoded type II transmembrane protein interacts with dnax-activation protein 12 and may play a role in cell activation. Alternative splice variants have been described but their full-length sequence has not been determined. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.