Human SIRT5/SIR2L5 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_012241.5)

Cat. No.: pGMPC001574
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SIRT5/SIR2L5 Non-Viral expression plasmid (overexpression vector) for mouse SIRT5 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to SIRT5/SIR2L5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001574
Gene Name SIRT5
Accession Number NM_012241.5
Gene ID 23408
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 933 bp
Gene Alias SIR2L5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag HA (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCGACCTCTCCAGATTGTCCCAAGTCGATTGATTTCCCAGCTATATTGTGGCCTGAAGCCTCCAGCGTCCACACGAAACCAGATTTGCCTGAAAATGGCTCGGCCAAGTTCAAGTATGGCAGATTTTCGAAAGTTTTTTGCAAAAGCAAAGCACATAGTCATCATCTCAGGAGCTGGTGTTAGTGCAGAAAGTGGTGTTCCGACCTTCAGAGGAGCTGGAGGTTATTGGAGAAAATGGCAAGCCCAGGACCTGGCGACTCCCCTGGCCTTTGCCCACAACCCGTCCCGGGTGTGGGAGTTCTACCACTACCGGCGGGAGGTCATGGGGAGCAAGGAGCCCAACGCCGGGCACCGCGCCATAGCCGAGTGTGAGACCCGGCTGGGCAAGCAGGGCCGGCGAGTCGTGGTCATCACCCAGAACATCGATGAGCTGCACCGCAAGGCTGGCACCAAGAACCTTCTGGAGATCCATGGTAGCTTATTTAAAACTCGATGTACCTCTTGTGGAGTTGTGGCTGAGAATTACAAGAGTCCAATTTGTCCAGCTTTATCAGGAAAAGGTGCTCCAGAACCTGGAACTCAAGATGCCAGCATCCCAGTTGAGAAACTTCCCCGGTGTGAAGAGGCAGGCTGCGGGGGCTTGCTGCGACCTCACGTCGTGTGGTTTGGAGAAAACCTGGATCCTGCCATTCTGGAGGAGGTTGACAGAGAGCTCGCCCACTGTGATTTATGTCTAGTGGTGGGCACTTCCTCTGTGGTGTACCCAGCAGCCATGTTTGCCCCCCAGGTGGCTGCCAGGGGCGTGCCAGTGGCTGAATTTAACACGGAGACCACCCCAGCTACGAACAGATTCAGGTTTCATTTCCAGGGACCCTGTGGAACGACTCTTCCTGAAGCCCTTGCCTGTCATGAAAATGAAACTGTTTCTTAA
ORF Protein Sequence MRPLQIVPSRLISQLYCGLKPPASTRNQICLKMARPSSSMADFRKFFAKAKHIVIISGAGVSAESGVPTFRGAGGYWRKWQAQDLATPLAFAHNPSRVWEFYHYRREVMGSKEPNAGHRAIAECETRLGKQGRRVVVITQNIDELHRKAGTKNLLEIHGSLFKTRCTSCGVVAENYKSPICPALSGKGAPEPGTQDASIPVEKLPRCEEAGCGGLLRPHVVWFGENLDPAILEEVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAEFNTETTPATNRFRFHFQGPCGTTLPEALACHENETVS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T91940-Ab Anti-SIRT5 monoclonal antibody
    Target Antigen GM-Tg-g-T91940-Ag SIRT5 protein
    ORF Viral Vector pGMLV000133 Human SIRT5 Lentivirus plasmid
    ORF Viral Vector pGMLV001161 Human sirt5 Lentivirus plasmid
    ORF Viral Vector pGMPC000230 Human SIRT5 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC000483 Human SIRT5 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001574 Human SIRT5 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLV000133 Human SIRT5 Lentivirus particle
    ORF Viral Vector vGMLV001161 Human sirt5 Lentivirus particle


    Target information

    Target ID GM-T91940
    Target Name SIRT5
    Gene ID 23408, 68346, 700855, 306840, 101089862, 478726, 507347, 100051757
    Gene Symbol and Synonyms 0610012J09Rik,1500032M05Rik,SIR2L5,SIRT5
    Uniprot Accession Q9NXA8
    Uniprot Entry Name SIR5_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000124523
    Target Classification Not Available

    This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.