Human VAMP2/NEDHAHM/SYB2 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_014232)

Cat. No.: pGMPC001583
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human VAMP2/NEDHAHM/SYB2 Non-Viral expression plasmid (overexpression vector) for mouse VAMP2 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to VAMP2/NEDHAHM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001583
Gene Name VAMP2
Accession Number NM_014232
Gene ID 6844
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 351 bp
Gene Alias NEDHAHM,SYB2,VAMP-2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTGCTACCGCTGCCACGGCCCCCCCTGCTGCCCCGGCTGGGGAGGGTGGTCCCCCTGCACCCCCTCCAAACCTCACCAGTAACAGGAGACTGCAGCAGACCCAGGCCCAGGTGGATGAGGTGGTGGACATCATGAGGGTGAACGTGGACAAGGTCCTGGAGCGAGACCAGAAGCTGTCGGAGCTGGACGACCGTGCAGATGCACTCCAGGCGGGGGCCTCCCAGTTTGAAACAAGCGCAGCCAAGCTCAAGCGCAAATACTGGTGGAAAAACCTCAAGATGATGATCATCTTGGGAGTGATTTGCGCCATCATCCTCATCATCATCATAGTTTACTTCAGCACTTAA
ORF Protein Sequence MSATAATAPPAAPAGEGGPPAPPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLKMMIILGVICAIILIIIIVYFST

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-TA101-Ab Anti-VAMP2/ SYB2/ VAMP-2 monoclonal antibody
    Target Antigen GM-Tg-g-TA101-Ag VAMP2 VLP (virus-like particle)
    ORF Viral Vector pGMLP000806 Human VAMP2 Lentivirus plasmid
    ORF Viral Vector pGMPC001583 Human VAMP2 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000806 Human VAMP2 Lentivirus particle


    Target information

    Target ID GM-TA101
    Target Name VAMP2
    Gene ID 6844, 22318, 574134, 24803, 101101516, 479491, 282116, 100073047
    Gene Symbol and Synonyms NEDHAHM,RATVAMPB,RATVAMPIR,SYB,Syb-2,SYB2,sybII,VAMP-2,VAMP2
    Uniprot Accession P63027
    Uniprot Entry Name VAMP2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000220205
    Target Classification Not Available

    The protein encoded by this gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family. Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein SNAP25 are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is thought to participate in neurotransmitter release at a step between docking and fusion. The protein forms a stable complex with syntaxin, synaptosomal-associated protein, 25 kD, and synaptotagmin. It also forms a distinct complex with synaptophysin. It is a likely candidate gene for familial infantile myasthenia (FIMG) because of its map location and because it encodes a synaptic vesicle protein of the type that has been implicated in the pathogenesis of FIMG. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.