Human IFITM1/9-27/CD225 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_003641.5)

Cat. No.: pGMPC001656
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human IFITM1/9-27/CD225 Non-Viral expression plasmid (overexpression vector) for mouse IFITM1 overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to IFITM1/9-27 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001656
Gene Name IFITM1
Accession Number NM_003641.5
Gene ID 8519
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 378 bp
Gene Alias 9-27,CD225,DSPA2a,IFI17,LEU13
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCACAAGGAGGAACATGAGGTGGCTGTGCTGGGGCCACCCCCCAGCACCATCCTTCCAAGGTCCACCGTGATCAACATCCACAGCGAGACCTCCGTGCCCGACCATGTCGTCTGGTCCCTGTTCAACACCCTCTTCTTGAACTGGTGCTGTCTGGGCTTCATAGCATTCGCCTACTCCGTGAAGTCTAGGGACAGGAAGATGGTTGGCGACGTGACCGGGGCCCAGGCCTATGCCTCCACCGCCAAGTGCCTGAACATCTGGGCCCTGATTCTGGGCATCCTCATGACCATTGGATTCATCCTGTTACTGGTATTCGGCTCTGTGACAGTCTACCATATTATGTTACAGATAATACAGGAAAAACGGGGTTACTAG
ORF Protein Sequence MHKEEHEVAVLGPPPSTILPRSTVINIHSETSVPDHVVWSLFNTLFLNWCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTIGFILLLVFGSVTVYHIMLQIIQEKRGY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0603-Ab Anti-IFM1/ IFITM1/CD225 monoclonal antibody
    Target Antigen GM-Tg-g-MP0603-Ag IFITM1 VLP (virus-like particle)
    ORF Viral Vector pGMLP000062 Human IFITM1 Lentivirus plasmid
    ORF Viral Vector pGMPC001656 Human IFITM1 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000062 Human IFITM1 Lentivirus particle


    Target information

    Target ID GM-MP0603
    Target Name IFITM1
    Gene ID 8519
    Gene Symbol and Synonyms 9-27,CD225,DSPA2a,IFI17,IFITM1,LEU13
    Uniprot Accession P13164
    Uniprot Entry Name IFM1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000185885
    Target Classification Tumor-associated antigen (TAA)

    Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 that belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2. [provided by RefSeq, Nov 2021]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.