Human STARD4 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_139164.3)

Cat. No.: pGMPC001741
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human STARD4/ Non-Viral expression plasmid (overexpression vector) for mouse STARD4 overexpression in unique cell transient transfection and stable cell line development.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to STARD4/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001741
Gene Name STARD4
Accession Number NM_139164.3
Gene ID 134429
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 618 bp
Gene Alias
Fluorescent Reporter Null
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGAAGGCCTGTCTGATGTTGCTTCTTTTGCAACTAAACTTAAAAACACTCTCATCCAGTACCATAGCATTGAAGAAGATAAGTGGCGAGTTGCTAAGAAAACGAAAGATGTAACTGTTTGGAGAAAACCCTCAGAAGAATTTAATGGATATCTCTACAAAGCCCAAGGTGTTATAGATGACCTTGTCTATAGTATAATAGACCATATACGCCCAGGGCCTTGTCGTTTGGATTGGGACAGCTTGATGACTTCTTTGGATATTCTGGAGAACTTTGAAGAGAATTGCTGTGTGATGCGTTACACTACTGCTGGTCAGCTTTGGAATATAATTTCCCCAAGAGAATTTGTTGATTTCTCCTATACTGTGGGCTATAAAGAAGGGCTTTTATCTTGTGGAATAAGTCTTGACTGGGATGAAAAGAGACCAGAATTTGTTCGAGGATATAACCATCCCTGTGGTTGGTTTTGTGTTCCACTTAAAGACAACCCAAACCAGAGTCTTTTGACAGGATATATTCAGACAGATCTGCGTGGGATGATTCCTCAGTCTGCGGTAGATACAGCCATGGCAAGCACTTTAACCAACTTCTATGGTGATTTACGAAAAGCTTTATGA
ORF Protein Sequence MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHIRPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDEKRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2757-Ab Anti-STARD4 monoclonal antibody
    Target Antigen GM-Tg-g-IP2757-Ag STARD4 protein
    ORF Viral Vector pGMPC001741 Human STARD4 Mammalian (Non-Viral Vector) plasmid


    Target information

    Target ID GM-IP2757
    Target Name STARD4
    Gene ID 134429, 170459, 706654, 291699, 101086371, 479141, 100073191
    Gene Symbol and Synonyms 4632419C16Rik,9030213J02Rik,STARD4
    Uniprot Accession Q96DR4
    Uniprot Entry Name STAR4_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000164211
    Target Classification Not Available

    Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM, Mar 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.