Human UBE2C/dJ447F3.2/UBCH10 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_007019)

Cat. No.: pGMPC001832
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human UBE2C/dJ447F3.2/UBCH10 Non-Viral expression plasmid (overexpression vector) for mouse UBE2C overexpression in unique cell transient transfection and stable cell line development.


Target products collection

Go to UBE2C/dJ447F3.2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMPC001832
Gene Name UBE2C
Accession Number NM_007019
Gene ID 11065
Species Human
Product Type Mammalian (Non-Viral Vector) plasmid (overexpression)
Insert Length 540 bp
Gene Alias dJ447F3.2,UBCH10
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTTCCCAAAACCGCGACCCAGCCGCCACTAGCGTCGCCGCCGCCCGTAAAGGAGCTGAGCCGAGCGGGGGCGCCGCCCGGGGTCCGGTGGGCAAAAGGCTACAGCAGGAGCTGATGACCCTCATGATGTCTGGCGATAAAGGGATTTCTGCCTTCCCTGAATCAGACAACCTTTTCAAATGGGTAGGGACCATCCATGGAGCAGCTGGAACAGTATATGAAGACCTGAGGTATAAGCTCTCGCTAGAGTTCCCCAGTGGCTACCCTTACAATGCGCCCACAGTGAAGTTCCTCACGCCCTGCTATCACCCCAACGTGGACACCCAGGGTAACATATGCCTGGACATCCTGAAGGAAAAGTGGTCTGCCCTGTATGATGTCAGGACCATTCTGCTCTCCATCCAGAGCCTTCTAGGAGAACCCAACATTGATAGTCCCTTGAACACACATGCTGCCGAGCTCTGGAAAAACCCCACAGCTTTTAAGAAGTACCTGCAAGAAACCTACTCAAAGCAGGTCACCAGCCAGGAGCCCTGA
ORF Protein Sequence MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2372-Ab Anti-UBE2C/ UBCH10/ dJ447F3.2 monoclonal antibody
    Target Antigen GM-Tg-g-MP2372-Ag UBE2C VLP (virus-like particle)
    ORF Viral Vector pGMLP000350 Human UBE2C Lentivirus plasmid
    ORF Viral Vector pGMPC001489 Human UBE2C Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC001832 Human UBE2C Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP000350 Human UBE2C Lentivirus particle


    Target information

    Target ID GM-MP2372
    Target Name UBE2C
    Gene ID 11065, 68612, 709380, 296368, 101087052, 485898, 506962, 100056334
    Gene Symbol and Synonyms 1110015A16Rik,D2Ertd695e,dJ447F3.2,UBCH10,UBE2C
    Uniprot Accession O00762
    Uniprot Entry Name UBE2C_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Breast Cancer
    Gene Ensembl ENSG00000175063
    Target Classification Not Available

    The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, ubiquitin-conjugating enzymes, and ubiquitin-protein ligases. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein is required for the destruction of mitotic cyclins and for cell cycle progression, and may be involved in cancer progression. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been defined on chromosomes 4, 14, 15, 18, and 19. [provided by RefSeq, Aug 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.