Human IL21/CVID11/IL-21 ORF/cDNA clone-Mammalian (Non-Viral Vector) plasmid (NM_021803.4)
Cat. No.: pGMPC004772
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human IL21/CVID11/IL-21 Non-Viral expression plasmid (overexpression vector) for mouse IL21 overexpression in unique cell transient transfection and stable cell line development.
Go to
IL21/CVID11 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMPC004772 |
Gene Name | IL21 |
Accession Number | NM_021803.4 |
Gene ID | 59067 |
Species | Human |
Product Type | Mammalian (Non-Viral Vector) plasmid (overexpression) |
Insert Length | 489 bp |
Gene Alias | CVID11,IL-21,Za11 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | Null |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGAGATCCAGTCCTGGCAACATGGAGAGGATTGTCATCTGTCTGATGGTCATCTTCTTGGGGACACTGGTCCACAAATCAAGCTCCCAAGGTCAAGATCGCCACATGATTAGAATGCGTCAACTTATAGATATTGTTGATCAGCTGAAAAATTATGTGAATGACTTGGTCCCTGAATTTCTGCCAGCTCCAGAAGATGTAGAGACAAACTGTGAGTGGTCAGCTTTTTCCTGCTTTCAGAAGGCCCAACTAAAGTCAGCAAATACAGGAAACAATGAAAGGATAATCAATGTATCAATTAAAAAGCTGAAGAGGAAACCACCTTCCACAAATGCAGGGAGAAGACAGAAACACAGACTAACATGCCCTTCATGTGATTCTTATGAGAAAAAACCACCCAAAGAATTCCTAGAAAGATTCAAATCACTTCTCCAAAAGATGATTCATCAGCATCTGTCCTCTAGAACACACGGAAGTGAAGATTCCTGA |
ORF Protein Sequence | MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-ab-041 | Pre-Made Avizakimab biosimilar, Whole mAb, Anti-IL21 Antibody: Anti-CVID11/IL-21/Za11 therapeutic antibody |
Target Antibody | GM-Tg-g-T51223-Ab | Anti-IL21/ CVID11/ IL-21 functional antibody |
Target Antigen | GM-Tg-g-T51223-Ag | IL21 protein |
ORF Viral Vector | pGMLP002995 | Human IL21 Lentivirus plasmid |
ORF Viral Vector | pGMLP-IL-028 | Human IL21 Lentivirus plasmid |
ORF Viral Vector | pGMAP-IL-111 | Human IL21 Adenovirus plasmid |
ORF Viral Vector | pGMPC001659 | Human IL21 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC004772 | Human IL21 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP002995 | Human IL21 Lentivirus particle |
ORF Viral Vector | vGMLP-IL-028 | Human IL21 Lentivirus particle |
ORF Viral Vector | vGMAP-IL-111 | Human IL21 Adenovirus particle |
Target information
Target ID | GM-T51223 |
Target Name | IL21 |
Gene ID | 59067, 60505, 708125, 365769, 101087399, 442935, 378475, 100063803 |
Gene Symbol and Synonyms | CVID11,IL-21,IL21,Za11 |
Uniprot Accession | Q9HBE4 |
Uniprot Entry Name | IL21_HUMAN |
Protein Sub-location | Secreted Protein/Potential Cytokines |
Category | Therapeutics Target, INN Index |
Disease | Cancer |
Gene Ensembl | ENSG00000138684 |
Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.