Human IL21/CVID11/IL-21 ORF/cDNA clone-Lentivirus particle (NM_021803)

Cat. No.: vGMLP-IL-028

Pre-made Human IL21/CVID11/IL-21 Lentiviral expression plasmid for IL21 lentivirus packaging, IL21 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IL21/CVID11 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP-IL-028 Human IL21 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP-IL-028
Gene Name IL21
Accession Number NM_021803
Gene ID 59067
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 489 bp
Gene Alias CVID11,IL-21,Za11
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGATCCAGTCCTGGCAACATGGAGAGGATTGTCATCTGTCTGATGGTCATCTTCTTGGGGACACTGGTCCACAAATCAAGCTCCCAAGGTCAAGATCGCCACATGATTAGAATGCGTCAACTTATAGATATTGTTGATCAGCTGAAAAATTATGTGAATGACTTGGTCCCTGAATTTCTGCCAGCTCCAGAAGATGTAGAGACAAACTGTGAGTGGTCAGCTTTTTCCTGCTTTCAGAAGGCCCAACTAAAGTCAGCAAATACAGGAAACAATGAAAGGATAATCAATGTATCAATTAAAAAGCTGAAGAGGAAACCACCTTCCACAAATGCAGGGAGAAGACAGAAACACAGACTAACATGCCCTTCATGTGATTCTTATGAGAAAAAACCACCCAAAGAATTCCTAGAAAGATTCAAATCACTTCTCCAAAAGATGATTCATCAGCATCTGTCCTCTAGAACACACGGAAGTGAAGATTCCTGA
ORF Protein Sequence MRSSPGNMERIVICLMVIFLGTLVHKSSSQGQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-041 Pre-Made Avizakimab biosimilar, Whole mAb, Anti-IL21 Antibody: Anti-CVID11/IL-21/Za11 therapeutic antibody
    Target Antibody GM-Tg-g-T51223-Ab Anti-IL21/ CVID11/ IL-21 functional antibody
    Target Antigen GM-Tg-g-T51223-Ag IL21 protein
    ORF Viral Vector pGMLP002995 Human IL21 Lentivirus plasmid
    ORF Viral Vector pGMLP-IL-028 Human IL21 Lentivirus plasmid
    ORF Viral Vector pGMAP-IL-111 Human IL21 Adenovirus plasmid
    ORF Viral Vector pGMPC001659 Human IL21 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector pGMPC004772 Human IL21 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP002995 Human IL21 Lentivirus particle
    ORF Viral Vector vGMLP-IL-028 Human IL21 Lentivirus particle
    ORF Viral Vector vGMAP-IL-111 Human IL21 Adenovirus particle


    Target information

    Target ID GM-T51223
    Target Name IL21
    Gene ID 59067, 60505, 708125, 365769, 101087399, 442935, 378475, 100063803
    Gene Symbol and Synonyms CVID11,IL-21,IL21,Za11
    Uniprot Accession Q9HBE4
    Uniprot Entry Name IL21_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target, INN Index
    Disease Cancer
    Gene Ensembl ENSG00000138684
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a member of the common-gamma chain family of cytokines with immunoregulatory activity. The encoded protein plays a role in both the innate and adaptive immune responses by inducing the differentiation, proliferation and activity of multiple target cells including macrophages, natural killer cells, B cells and cytotoxic T cells. Dysregulation of this gene plays a role in multiple immune-mediated diseases including lupus, psoriasis and chronic inflammatory diseases. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Dec 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.