Human RGS5/MST092/MST106 ORF/cDNA clone-Adenovirus particle (NM_003617.3)
Cat. No.: vGMAD000157
Pre-made Human RGS5/MST092/MST106 Adenovirus for RGS5 overexpression in-vitro and in-vivo. The RGS5 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified RGS5-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
RGS5/MST092 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAD000157 | Human RGS5 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAD000157 |
Gene Name | RGS5 |
Accession Number | NM_003617.3 |
Gene ID | 8490 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 546 bp |
Gene Alias | MST092,MST106,MST129,MSTP032,MSTP092,MSTP106,MSTP129 |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGTGCAAAGGACTTGCAGCTTTGCCCCACTCATGCCTGGAAAGGGCCAAGGAGATTAAGATCAAGTTGGGAATTCTCCTCCAGAAGCCAGACTCAGTTGGTGACCTTGTCATTCCGTACAATGAGAAGCCAGAGAAACCAGCCAAGACCCAGAAAACCTCGCTGGACGAGGCCCTGCAGTGGCGTGATTCCCTGGACAAACTCCTGCAGAACAACTATGGACTTGCCAGTTTCAAAAGTTTCCTGAAGTCTGAATTCAGTGAGGAAAACCTTGAGTTCTGGATTGCCTGTGAGGATTACAAGAAGATCAAGTCCCCTGCCAAGATGGCTGAGAAGGCAAAGCAAATTTATGAAGAATTCATTCAAACGGAGGCTCCTAAAGAGGTGAATATTGACCACTTCACTAAGGACATCACAATGAAGAACCTGGTGGAACCTTCCCTGAGCAGCTTTGACATGGCCCAGAAAAGAATCCATGCCCTGATGGAAAAGGATTCTCTGCCTCGCTTTGTGCGCTCTGAGTTTTATCAGGAGTTAATCAAGTAG |
ORF Protein Sequence | MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP2407-Ab | Anti-RGS5/ MST092/ MST106 monoclonal antibody |
Target Antigen | GM-Tg-g-MP2407-Ag | RGS5 VLP (virus-like particle) |
ORF Viral Vector | pGMAD000157 | Human RGS5 Adenovirus plasmid |
ORF Viral Vector | vGMAD000157 | Human RGS5 Adenovirus particle |
Target information
Target ID | GM-MP2407 |
Target Name | RGS5 |
Gene ID | 8490, 19737, 693510, 54294, 101082542, 488667, 540509, 100059437 |
Gene Symbol and Synonyms | 1110070A02Rik,MST092,MST106,MST129,MSTP032,MSTP092,MSTP106,MSTP129,RGS5 |
Uniprot Accession | O15539 |
Uniprot Entry Name | RGS5_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000143248 |
Target Classification | Not Available |
This gene encodes a member of the regulators of G protein signaling (RGS) family. The RGS proteins are signal transduction molecules which are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators. This gene is a hypoxia-inducible factor-1 dependent, hypoxia-induced gene which is involved in the induction of endothelial apoptosis. This gene is also one of three genes on chromosome 1q contributing to elevated blood pressure. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Dec 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.