Human RGS5/MST092/MST106 ORF/cDNA clone-Adenovirus particle (NM_003617.3)

Cat. No.: vGMAD000157

Pre-made Human RGS5/MST092/MST106 Adenovirus for RGS5 overexpression in-vitro and in-vivo. The RGS5 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified RGS5-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to RGS5/MST092 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000157 Human RGS5 Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000157
Gene Name RGS5
Accession Number NM_003617.3
Gene ID 8490
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 546 bp
Gene Alias MST092,MST106,MST129,MSTP032,MSTP092,MSTP106,MSTP129
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGTGCAAAGGACTTGCAGCTTTGCCCCACTCATGCCTGGAAAGGGCCAAGGAGATTAAGATCAAGTTGGGAATTCTCCTCCAGAAGCCAGACTCAGTTGGTGACCTTGTCATTCCGTACAATGAGAAGCCAGAGAAACCAGCCAAGACCCAGAAAACCTCGCTGGACGAGGCCCTGCAGTGGCGTGATTCCCTGGACAAACTCCTGCAGAACAACTATGGACTTGCCAGTTTCAAAAGTTTCCTGAAGTCTGAATTCAGTGAGGAAAACCTTGAGTTCTGGATTGCCTGTGAGGATTACAAGAAGATCAAGTCCCCTGCCAAGATGGCTGAGAAGGCAAAGCAAATTTATGAAGAATTCATTCAAACGGAGGCTCCTAAAGAGGTGAATATTGACCACTTCACTAAGGACATCACAATGAAGAACCTGGTGGAACCTTCCCTGAGCAGCTTTGACATGGCCCAGAAAAGAATCCATGCCCTGATGGAAAAGGATTCTCTGCCTCGCTTTGTGCGCTCTGAGTTTTATCAGGAGTTAATCAAGTAG
ORF Protein Sequence MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2407-Ab Anti-RGS5/ MST092/ MST106 monoclonal antibody
    Target Antigen GM-Tg-g-MP2407-Ag RGS5 VLP (virus-like particle)
    ORF Viral Vector pGMAD000157 Human RGS5 Adenovirus plasmid
    ORF Viral Vector vGMAD000157 Human RGS5 Adenovirus particle


    Target information

    Target ID GM-MP2407
    Target Name RGS5
    Gene ID 8490, 19737, 693510, 54294, 101082542, 488667, 540509, 100059437
    Gene Symbol and Synonyms 1110070A02Rik,MST092,MST106,MST129,MSTP032,MSTP092,MSTP106,MSTP129,RGS5
    Uniprot Accession O15539
    Uniprot Entry Name RGS5_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000143248
    Target Classification Not Available

    This gene encodes a member of the regulators of G protein signaling (RGS) family. The RGS proteins are signal transduction molecules which are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators. This gene is a hypoxia-inducible factor-1 dependent, hypoxia-induced gene which is involved in the induction of endothelial apoptosis. This gene is also one of three genes on chromosome 1q contributing to elevated blood pressure. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Dec 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.