Human FCER1G/FCRG ORF/cDNA clone-Adenovirus particle (NM_004106.2)

Cat. No.: vGMAD000910

Pre-made Human FCER1G/FCRG Adenovirus for FCER1G overexpression in-vitro and in-vivo. The FCER1G adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified FCER1G-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.

At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.

Target products collection

Go to FCERG/FCER1G/FCRG products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name Adenovirus Grade Adenovirus quantity
vGMAD000910 Human FCER1G Adenovirus particle Research Grade-In vitro 1E+10PFU (1E+10pfu/ml×1ml)
5E+10PFU (1E+10pfu/ml×5ml)
1E+11PFU (1E+10pfu/ml×10ml)
Research Grade-In vivo 1E+11PFU (1E+11pfu/ml×1ml)
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAD000910
Gene Name FCER1G
Accession Number NM_004106.2
Gene ID 2207
Species Human
Product Type Adenovirus particle (overexpression)
Insert Length 261 bp
Gene Alias FCRG
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGATTCCAGCAGTGGTCTTGCTCTTACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGGAGAGCCTCAGCTCTGCTATATCCTGGATGCCATCCTGTTTCTGTATGGAATTGTCCTCACCCTCCTCTACTGTCGACTGAAGATCCAAGTGCGAAAGGCAGCTATAACCAGCTATGAGAAATCAGATGGTGTTTACACGGGCCTGAGCACCAGGAACCAGGAGACTTACGAGACTCTGAAGCATGAGAAACCACCACAGTAG
ORF Protein Sequence MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T95400-Ab Anti-FCERG/ FCER1G/ FCRG monoclonal antibody
    Target Antigen GM-Tg-g-T95400-Ag FCERG/FCER1G VLP (virus-like particle)
    ORF Viral Vector pGMLP004456 Human FCER1G Lentivirus plasmid
    ORF Viral Vector pGMAD000910 Human FCER1G Adenovirus plasmid
    ORF Viral Vector vGMLP004456 Human FCER1G Lentivirus particle
    ORF Viral Vector vGMAD000910 Human FCER1G Adenovirus particle


    Target information

    Target ID GM-T95400
    Target Name FCERG
    Gene ID 2207, 14127, 720291, 25441, 101089236, 403798, 282226, 100034137
    Gene Symbol and Synonyms CD23,Fce1g,FcepsilonRI,FCER1G,FcR-gamma,FCRG,FcRgamma,FcR[g],Ly-50
    Uniprot Accession P30273
    Uniprot Entry Name FCERG_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000158869
    Target Classification Not Available

    The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.