Human FCER1G/FCRG ORF/cDNA clone-Adenovirus particle (NM_004106.2)
Cat. No.: vGMAD000910
Pre-made Human FCER1G/FCRG Adenovirus for FCER1G overexpression in-vitro and in-vivo. The FCER1G adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified FCER1G-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
FCERG/FCER1G/FCRG products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
vGMAD000910 | Human FCER1G Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
5E+10PFU (1E+10pfu/ml×5ml) | |||
1E+11PFU (1E+10pfu/ml×10ml) | |||
Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMAD000910 |
Gene Name | FCER1G |
Accession Number | NM_004106.2 |
Gene ID | 2207 |
Species | Human |
Product Type | Adenovirus particle (overexpression) |
Insert Length | 261 bp |
Gene Alias | FCRG |
Fluorescent Reporter | EGFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Kanamycin |
ORF Nucleotide Sequence | ATGATTCCAGCAGTGGTCTTGCTCTTACTCCTTTTGGTTGAACAAGCAGCGGCCCTGGGAGAGCCTCAGCTCTGCTATATCCTGGATGCCATCCTGTTTCTGTATGGAATTGTCCTCACCCTCCTCTACTGTCGACTGAAGATCCAAGTGCGAAAGGCAGCTATAACCAGCTATGAGAAATCAGATGGTGTTTACACGGGCCTGAGCACCAGGAACCAGGAGACTTACGAGACTCTGAAGCATGAGAAACCACCACAGTAG |
ORF Protein Sequence | MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T95400-Ab | Anti-FCERG/ FCER1G/ FCRG monoclonal antibody |
Target Antigen | GM-Tg-g-T95400-Ag | FCERG/FCER1G VLP (virus-like particle) |
ORF Viral Vector | pGMLP004456 | Human FCER1G Lentivirus plasmid |
ORF Viral Vector | pGMAD000910 | Human FCER1G Adenovirus plasmid |
ORF Viral Vector | vGMLP004456 | Human FCER1G Lentivirus particle |
ORF Viral Vector | vGMAD000910 | Human FCER1G Adenovirus particle |
Target information
Target ID | GM-T95400 |
Target Name | FCERG |
Gene ID | 2207, 14127, 720291, 25441, 101089236, 403798, 282226, 100034137 |
Gene Symbol and Synonyms | CD23,Fce1g,FcepsilonRI,FCER1G,FcR-gamma,FCRG,FcRgamma,FcR[g],Ly-50 |
Uniprot Accession | P30273 |
Uniprot Entry Name | FCERG_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Not Available |
Gene Ensembl | ENSG00000158869 |
Target Classification | Not Available |
The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.