Human CD59/16.3A5/1F5 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_000611.5)
Cat. No.: pGMAAV000004
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CD59/16.3A5/1F5 Adeno-associated virus expression plasmid (ITR-vector) for CD59 AAV packaging, CD59 AAV production.The purified Human CD59/16.3A5/1F5 AAV particle serves as an invaluable asset for in-depth in vivo CD59 studies, mechanism of action (MOA) research, and the evolution of CD59-associated gene therapy strategies.
Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.
Go to
CD59/16.3A5 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAAV000004 |
Gene Name | CD59 |
Accession Number | NM_000611.5 |
Gene ID | 966 |
Species | Human |
Product Type | Adeno-associate virus(AAV) plasmid (overexpression) |
Insert Length | 387 bp |
Gene Alias | 16.3A5,1F5,EJ16,EJ30,EL32,G344,HRF-20,HRF20,MAC-IP,MACIF,MEM43,MIC11,MIN1,MIN2,MIN3,MIRL,MSK21,p18-20 |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGGAATCCAAGGAGGGTCTGTCCTGTTCGGGCTGCTGCTCGTCCTGGCTGTCTTCTGCCATTCAGGTCATAGCCTGCAGTGCTACAACTGTCCTAACCCAACTGCTGACTGCAAAACAGCCGTCAATTGTTCATCTGATTTTGATGCGTGTCTCATTACCAAAGCTGGGTTACAAGTGTATAACAAGTGTTGGAAGTTTGAGCATTGCAATTTCAACGACGTCACAACCCGCTTGAGGGAAAATGAGCTAACGTACTACTGCTGCAAGAAGGACCTGTGTAACTTTAACGAACAGCTTGAAAATGGTGGGACATCCTTATCAGAGAAAACAGTTCTTCTGCTGGTGACTCCATTTCTGGCAGCAGCCTGGAGCCTTCATCCCTAA |
ORF Protein Sequence | MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T78552-Ab | Anti-CD59/ 16.3A5/ 1F5 monoclonal antibody |
Target Antigen | GM-Tg-g-T78552-Ag | CD59 VLP (virus-like particle) |
ORF Viral Vector | pGMAAV000004 | Human CD59 Adeno-associate virus(AAV) plasmid |
ORF Viral Vector | vGMAAV000004 | Human CD59 Adeno-associate virus(AAV) particle |
Target information
Target ID | GM-T78552 |
Target Name | CD59 |
Gene ID | 966, 693402, 25407, 101092210, 475945, 505574, 106781397 |
Gene Symbol and Synonyms | 16.3A5,1F5,CD59,Cd59a,Cd59b,EJ16,EJ30,EL32,G344,HRF-20,HRF20,MAC-IP,MACIF,MACIP,MEM43,MIC11,MIN1,MIN2,MIN3,MIRL,MSK21,p18-20 |
Uniprot Accession | P13987 |
Uniprot Entry Name | CD59_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Ovary Cancer, Contact with and (suspected) exposure to environmental tobacco smoke (acute) (chronic), Contrast - Induced Nephropathy, Dent disease, IgA glomerulonephritis, Ovarian cancer, Type 1 diabetes mellitus |
Gene Ensembl | ENSG00000085063 |
Target Classification | Not Available |
This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.