Human CD59/16.3A5/1F5 ORF/cDNA clone-Adeno-associate virus(AAV) particle (NM_000611.5)

Cat. No.: vGMAAV000004

Pre-made Human CD59/16.3A5/1F5 Adeno-associated virus particle for CD59 in-vivo study, mechanism of action (MOA) research and CD59-associated gene therapy development.

At GM Vector Core (GMVC), we stand at the forefront of custom AAV development and produce distinct grades of AAVs employing state-of-the-art methodologies. Uncover more about our expertise.

Target products collection

Go to CD59/16.3A5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name AAV serotype AAV Grade AAV quantity
vGMAAV000004 Human CD59 Adeno-associate virus(AAV) particle AAV1, AAV2, AAV2 variant (Y444F), AAV2 variant (Y272F, Y444F, Y500F, Y730F), AAV2 variant (Y444F, Y730F, Y500F, Y272F, Y704F, Y252F), AAV2 variant(AAV2.7m8), AAV5, AAV6, AAV8, AAV8-1m, AAV8-2m, AAV8 variant (Y733F, Y447F, Y275), AAV9, AAV-Rh.10, AAV-DJ, AAV-DJ/8, AAV-Retro (Retrograde), AAV9-PHP.B, AAV9-PHP.eB, AAV9-PHP.S, AAV-BR1, AAV-2i8, AAV-SIG, AAV-VEC, AAV4, AAV6.2, AAV6.2FF Pilot Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
Research Grade 1.0E+12VG/ml
5.0E+12VG/ml
1E+13VG/ml
5E+13VG/ml
1E+14VG/ml
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMAAV000004
Gene Name CD59
Accession Number NM_000611.5
Gene ID 966
Species Human
Product Type Adeno-associate virus(AAV) particle (overexpression)
Insert Length 387 bp
Gene Alias 16.3A5,1F5,EJ16,EJ30,EL32,G344,HRF-20,HRF20,MAC-IP,MACIF,MEM43,MIC11,MIN1,MIN2,MIN3,MIRL,MSK21,p18-20
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGAATCCAAGGAGGGTCTGTCCTGTTCGGGCTGCTGCTCGTCCTGGCTGTCTTCTGCCATTCAGGTCATAGCCTGCAGTGCTACAACTGTCCTAACCCAACTGCTGACTGCAAAACAGCCGTCAATTGTTCATCTGATTTTGATGCGTGTCTCATTACCAAAGCTGGGTTACAAGTGTATAACAAGTGTTGGAAGTTTGAGCATTGCAATTTCAACGACGTCACAACCCGCTTGAGGGAAAATGAGCTAACGTACTACTGCTGCAAGAAGGACCTGTGTAACTTTAACGAACAGCTTGAAAATGGTGGGACATCCTTATCAGAGAAAACAGTTCTTCTGCTGGTGACTCCATTTCTGGCAGCAGCCTGGAGCCTTCATCCCTAA
ORF Protein Sequence MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T78552-Ab Anti-CD59/ 16.3A5/ 1F5 monoclonal antibody
    Target Antigen GM-Tg-g-T78552-Ag CD59 VLP (virus-like particle)
    ORF Viral Vector pGMAAV000004 Human CD59 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMAAV000004 Human CD59 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T78552
    Target Name CD59
    Gene ID 966, 693402, 25407, 101092210, 475945, 505574, 106781397
    Gene Symbol and Synonyms 16.3A5,1F5,CD59,Cd59a,Cd59b,EJ16,EJ30,EL32,G344,HRF-20,HRF20,MAC-IP,MACIF,MACIP,MEM43,MIC11,MIN1,MIN2,MIN3,MIRL,MSK21,p18-20
    Uniprot Accession P13987
    Uniprot Entry Name CD59_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Ovary Cancer, Contact with and (suspected) exposure to environmental tobacco smoke (acute) (chronic), Contrast - Induced Nephropathy, Dent disease, IgA glomerulonephritis, Ovarian cancer, Type 1 diabetes mellitus
    Gene Ensembl ENSG00000085063
    Target Classification Not Available

    This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.