Human CRB3 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_139161.4)

Cat. No.: pGMAAV000094
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CRB3/ Adeno-associated virus expression plasmid (ITR-vector) for CRB3 AAV packaging, CRB3 AAV production.The purified Human CRB3/ AAV particle serves as an invaluable asset for in-depth in vivo CRB3 studies, mechanism of action (MOA) research, and the evolution of CRB3-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to CRB3/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000094
Gene Name CRB3
Accession Number NM_139161.4
Gene ID 92359
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 363 bp
Gene Alias
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag Null
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGAACCCCGGGCTGGGGCTGCTTCTGGCGCTGGGCCTGCCGTTCCTGCTGGCCCGCTGGGGCCGAGCCTGGGGGCAAATACAGACCACTTCTGCAAATGAGAATAGCACTGTTTTGCCTTCATCCACCAGCTCCAGCTCCGATGGCAACCTGCGTCCAGAAGCCATCACTGCTATCATCGTGGTCTTCTCCCTCTTGGCTGCCTTGCTCCTGGCTGTGGGGCTGGCACTGTTGGTGCGGAAGCTTCGGGAGAAGCGGCAGACGGAGGGCACCTACCGGCCCAGTAGCGAGGAGCAGGTGGGTGCCCGCGTGCCACCGACCCCCAACCTCAAGTTGCCGCCGGAAGAGCGGCTCATCTGA
ORF Protein Sequence MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0333-Ab Anti-CRUM3/ CRB3 monoclonal antibody
    Target Antigen GM-Tg-g-MP0333-Ag CRB3 VLP (virus-like particle)
    ORF Viral Vector pGMAAV000094 Human CRB3 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMAAV000094 Human CRB3 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-MP0333
    Target Name CRB3
    Gene ID 92359, 224912, 700086, 301112, 109493927, 100855851, 787466, 100065707
    Gene Symbol and Synonyms 5730439B18,CRB3
    Uniprot Accession Q9BUF7
    Uniprot Entry Name CRUM3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000130545
    Target Classification Not Available

    This gene encodes a member of the Crumbs family of proteins. This gene is widely expressed in epithelial tissues where the encoded protein isoforms play various roles such as the control of cytokinesis and ciliogenesis or the formation of tight junctions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.