Human TSPAN1/NET1/TM4C ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_005727.3)

Cat. No.: pGMAAV000169
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TSPAN1/NET1/TM4C Adeno-associated virus expression plasmid (ITR-vector) for TSPAN1 AAV packaging, TSPAN1 AAV production.The purified Human TSPAN1/NET1/TM4C AAV particle serves as an invaluable asset for in-depth in vivo TSPAN1 studies, mechanism of action (MOA) research, and the evolution of TSPAN1-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.


Target products collection

Go to TSPAN1/NET1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000169
Gene Name TSPAN1
Accession Number NM_005727.3
Gene ID 10103
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 726 bp
Gene Alias NET1,TM4C,TM4SF
Fluorescent Reporter Firefly luciferase
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCAGTGCTTCAGCTTCATTAAGACCATGATGATCCTCTTCAATTTGCTCATCTTTCTGTGTGGTGCAGCCCTGTTGGCAGTGGGCATCTGGGTGTCAATCGATGGGGCATCCTTTCTGAAGATCTTCGGGCCACTGTCGTCCAGTGCCATGCAGTTTGTCAACGTGGGCTACTTCCTCATCGCAGCCGGCGTTGTGGTCTTTGCTCTTGGTTTCCTGGGCTGCTATGGTGCTAAGACTGAGAGCAAGTGTGCCCTCGTGACGTTCTTCTTCATCCTCCTCCTCATCTTCATTGCTGAGGTTGCAGCTGCTGTGGTCGCCTTGGTGTACACCACAATGGCTGAGCACTTCCTGACGTTGCTGGTAGTGCCTGCCATCAAGAAAGATTATGGTTCCCAGGAAGACTTCACTCAAGTGTGGAACACCACCATGAAAGGGCTCAAGTGCTGTGGCTTCACCAACTATACGGATTTTGAGGACTCACCCTACTTCAAAGAGAACAGTGCCTTTCCCCCATTCTGTTGCAATGACAACGTCACCAACACAGCCAATGAAACCTGCACCAAGCAAAAGGCTCACGACCAAAAAGTAGAGGGTTGCTTCAATCAGCTTTTGTATGACATCCGAACTAATGCAGTCACCGTGGGTGGTGTGGCAGCTGGAATTGGGGGCCTCGAGCTGGCTGCCATGATTGTGTCCATGTATCTGTACTGCAATCTACAATAA
ORF Protein Sequence MQCFSFIKTMMILFNLLIFLCGAALLAVGIWVSIDGASFLKIFGPLSSSAMQFVNVGYFLIAAGVVVFALGFLGCYGAKTESKCALVTFFFILLLIFIAEVAAAVVALVYTTMAEHFLTLLVVPAIKKDYGSQEDFTQVWNTTMKGLKCCGFTNYTDFEDSPYFKENSAFPPFCCNDNVTNTANETCTKQKAHDQKVEGCFNQLLYDIRTNAVTVGGVAAGIGGLELAAMIVSMYLYCNLQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1880-Ab Anti-TSN1/ TSPAN1/ NET1 monoclonal antibody
    Target Antigen GM-Tg-g-MP1880-Ag TSPAN1 VLP (virus-like particle)
    ORF Viral Vector pGMAAV000169 Human TSPAN1 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMAAV000169 Human TSPAN1 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-MP1880
    Target Name TSPAN1
    Gene ID 10103, 66805, 707431, 298436, 101093789, 100856322, 506550, 100064866
    Gene Symbol and Synonyms 9030418M05Rik,NET1,TM4C,TM4SF,TSPAN1
    Uniprot Accession O60635
    Uniprot Entry Name TSN1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000117472
    Target Classification Not Available

    The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.