Human TREM2/PLOSL2/TREM-2 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_018965.4)

Cat. No.: pGMAAV000622
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human TREM2/PLOSL2/TREM-2 Adeno-associated virus expression plasmid (ITR-vector) for TREM2 AAV packaging, TREM2 AAV production.The purified Human TREM2/PLOSL2/TREM-2 AAV particle serves as an invaluable asset for in-depth in vivo TREM2 studies, mechanism of action (MOA) research, and the evolution of TREM2-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to TREM2/PLOSL2 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV000622
Gene Name TREM2
Accession Number NM_018965.4
Gene ID 54209
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 693 bp
Gene Alias PLOSL2,TREM-2,Trem2a,Trem2b,Trem2c
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag MYC (C-Terminal)
Promoter CD68
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGCCTCTCCGGCTGCTCATCTTACTCTTTGTCACAGAGCTGTCCGGAGCCCACAACACCACAGTGTTCCAGGGCGTGGCGGGCCAGTCCCTGCAGGTGTCTTGCCCCTATGACTCCATGAAGCACTGGGGGAGGCGCAAGGCCTGGTGCCGCCAGCTGGGAGAGAAGGGCCCATGCCAGCGTGTGGTCAGCACGCACAACTTGTGGCTGCTGTCCTTCCTGAGGAGGTGGAATGGGAGCACAGCCATCACAGACGATACCCTGGGTGGCACTCTCACCATTACGCTGCGGAATCTACAACCCCATGATGCGGGTCTCTACCAGTGCCAGAGCCTCCATGGCAGTGAGGCTGACACCCTCAGGAAGGTCCTGGTGGAGGTGCTGGCAGACCCCCTGGATCACCGGGATGCTGGAGATCTCTGGTTCCCCGGGGAGTCTGAGAGCTTCGAGGATGCCCATGTGGAGCACAGCATCTCCAGGAGCCTCTTGGAAGGAGAAATCCCCTTCCCACCCACTTCCATCCTTCTCCTCCTGGCCTGCATCTTTCTCATCAAGATTCTAGCAGCCAGCGCCCTCTGGGCTGCAGCCTGGCATGGACAGAAGCCAGGGACACATCCACCCAGTGAACTGGACTGTGGCCATGACCCAGGGTATCAGCTCCAAACTCTGCCAGGGCTGAGAGACACGTGA
ORF Protein Sequence MEPLRLLILLFVTELSGAHNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSISRSLLEGEIPFPPTSILLLLACIFLIKILAASALWAAAWHGQKPGTHPPSELDCGHDPGYQLQTLPGLRDT

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T45086-Ab Anti-TREM2/ TREM-2/ Trem2a monoclonal antibody
    Target Antigen GM-Tg-g-T45086-Ag TREM2 VLP (virus-like particle)
    ORF Viral Vector pGMLP003467 Human TREM2 Lentivirus plasmid
    ORF Viral Vector pGMAAV000622 Human TREM2 Adeno-associate virus(AAV) plasmid
    ORF Viral Vector vGMLP003467 Human TREM2 Lentivirus particle
    ORF Viral Vector vGMAAV000622 Human TREM2 Adeno-associate virus(AAV) particle


    Target information

    Target ID GM-T45086
    Target Name TREM2
    Gene ID 54209, 83433, 719740, 301227, 101099297, 119863908, 506467, 100066180
    Gene Symbol and Synonyms LOC119863908,PLOSL2,TREM-2,TREM2,Trem2-Mia,Trem2-Mib,Trem2a,Trem2b,Trem2c
    Uniprot Accession Q9NZC2
    Uniprot Entry Name TREM2_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000095970
    Target Classification Not Available

    This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.