Human MPZ/CHM/CHN2 ORF/cDNA clone-Adeno-associate virus(AAV) plasmid (NM_000530)

Cat. No.: pGMAAV001157
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human MPZ/CHM/CHN2 Adeno-associated virus expression plasmid (ITR-vector) for MPZ AAV packaging, MPZ AAV production.The purified Human MPZ/CHM/CHN2 AAV particle serves as an invaluable asset for in-depth in vivo MPZ studies, mechanism of action (MOA) research, and the evolution of MPZ-associated gene therapy strategies.

Our GM-AAV ITR vector is optimized with the G-NEXT™ multi-serotypes AAV vector system. Explore the G-NEXT™ system in detail.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to MPZ/CHM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAAV001157
Gene Name MPZ
Accession Number NM_000530
Gene ID 4359
Species Human
Product Type Adeno-associate virus(AAV) plasmid (overexpression)
Insert Length 747 bp
Gene Alias CHM,CHN2,CMT1,CMT1B,CMT2I,CMT2J,CMT4E,CMTDI3,CMTDID,DSS,HMSNIB,MPP,P0
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTCCTGGGGCTCCCTCATCCAGCCCCAGCCCTATCCTGGCTGTGCTGCTCTTCTCTTCTTTGGTGCTGTCCCCGGCCCAGGCCATCGTGGTTTACACCGACAGGGAGGTCCATGGTGCTGTGGGCTCCCGGGTGACCCTGCACTGCTCCTTCTGGTCCAGTGAGTGGGTCTCAGATGACATCTCCTTCACCTGGCGCTACCAGCCCGAAGGGGGCAGAGATGCCATTTCGATCTTCCACTATGCCAAGGGACAACCCTACATTGACGAGGTGGGGACCTTCAAAGAGCGCATCCAGTGGGTAGGGGACCCTCGCTGGAAGGATGGCTCCATTGTCATACACAACCTAGACTACAGTGACAATGGCACGTTCACTTGTGACGTCAAAAACCCTCCAGACATAGTGGGCAAGACCTCTCAGGTCACGCTGTATGTCTTTGAAAAAGTGCCAACTAGGTACGGGGTCGTTCTGGGAGCTGTGATCGGGGGTGTCCTCGGGGTGGTGCTGTTGCTGCTGCTGCTTTTCTACGTGGTTCGGTACTGCTGGCTACGCAGGCAGGCGGCCCTGCAGAGGAGGCTCAGTGCTATGGAGAAGGGGAAATTGCACAAGCCAGGAAAGGACGCGTCGAAGCGCGGGCGGCAGACGCCAGTGCTGTATGCAATGCTGGACCACAGCAGAAGCACCAAAGCTGTCAGTGAGAAGAAGGCCAAGGGGCTGGGGGAGTCTCGCAAGGATAAGAAATAG
ORF Protein Sequence MAPGAPSSSPSPILAVLLFSSLVLSPAQAIVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGVVLGAVIGGVLGVVLLLLLLFYVVRYCWLRRQAALQRRLSAMEKGKLHKPGKDASKRGRQTPVLYAMLDHSRSTKAVSEKKAKGLGESRKDKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0823-Ab Anti-MYP0/ MPZ/ CHM monoclonal antibody
    Target Antigen GM-Tg-g-MP0823-Ag MPZ VLP (virus-like particle)
    ORF Viral Vector pGMLP004500 Human MPZ Lentivirus plasmid
    ORF Viral Vector pGMAAV001157 Human MPZ Adeno-associate virus(AAV) plasmid
    ORF Viral Vector pGMLP-SPh-147 Human MPZ Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-298 Human MPZ Adenovirus plasmid
    ORF Viral Vector vGMLP004500 Human MPZ Lentivirus particle
    ORF Viral Vector vGMAAV001157 Human MPZ Adeno-associate virus(AAV) particle
    ORF Viral Vector vGMLP-SPh-147 Human MPZ Lentivirus particle
    ORF Viral Vector vGMAP-SPh-298 Human MPZ Adenovirus particle


    Target information

    Target ID GM-MP0823
    Target Name MPZ
    Gene ID 4359, 17528, 719969, 24564, 101088210, 488654, 539462, 100034024
    Gene Symbol and Synonyms CHM,CHN2,CMT1,CMT1B,CMT2I,CMT2J,CMT4E,CMTDI3,CMTDID,DSS,HMSNIB,MPP,MPZ,P-zero,P0
    Uniprot Accession P25189
    Uniprot Entry Name MYP0_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000158887
    Target Classification Not Available

    This gene is specifically expressed in Schwann cells of the peripheral nervous system and encodes a type I transmembrane glycoprotein that is a major structural protein of the peripheral myelin sheath. The encoded protein contains a large hydrophobic extracellular domain and a smaller basic intracellular domain, which are essential for the formation and stabilization of the multilamellar structure of the compact myelin. Mutations in this gene are associated with autosomal dominant form of Charcot-Marie-Tooth disease type 1 (CMT1B) and other polyneuropathies, such as Dejerine-Sottas syndrome (DSS) and congenital hypomyelinating neuropathy (CHN). A recent study showed that two isoforms are produced from the same mRNA by use of alternative in-frame translation termination codons via a stop codon readthrough mechanism. [provided by RefSeq, Oct 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.