Human FABP5/E-FABP/EFABP ORF/cDNA clone-Adenovirus plasmid (NM_001444)

Cat. No.: pGMAD000803
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FABP5/E-FABP/EFABP adenoviral expression plasmid for FABP5 adenovirus packaging, FABP5 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to FABP5/E-FABP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAD000803
Gene Name FABP5
Accession Number NM_001444
Gene ID 2171
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 408 bp
Gene Alias E-FABP,EFABP,KFABP,PA-FABP,PAFABP
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGCCACAGTTCAGCAGCTGGAAGGAAGATGGCGCCTGGTGGACAGCAAAGGCTTTGATGAATACATGAAGGAGCTAGGAGTGGGAATAGCTTTGCGAAAAATGGGCGCAATGGCCAAGCCAGATTGTATCATCACTTGTGATGGTAAAAACCTCACCATAAAAACTGAGAGCACTTTGAAAACAACACAGTTTTCTTGTACCCTGGGAGAGAAGTTTGAAGAAACCACAGCTGATGGCAGAAAAACTCAGACTGTCTGCAACTTTACAGATGGTGCATTGGTTCAGCATCAGGAGTGGGATGGGAAGGAAAGCACAATAACAAGAAAATTGAAAGATGGGAAATTAGTGGTGGAGTGTGTCATGAACAATGTCACCTGTACTCGGATCTATGAAAAAGTAGAATAA
ORF Protein Sequence MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T21507-Ab Anti-FABP5/ E-FABP/ EFABP monoclonal antibody
    Target Antigen GM-Tg-g-T21507-Ag FABP5 VLP (virus-like particle)
    ORF Viral Vector pGMLP004328 Human FABP5 Lentivirus plasmid
    ORF Viral Vector pGMAD000803 Human FABP5 Adenovirus plasmid
    ORF Viral Vector pGMPC001524 Human FABP5 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP004328 Human FABP5 Lentivirus particle
    ORF Viral Vector vGMAD000803 Human FABP5 Adenovirus particle


    Target information

    Target ID GM-T21507
    Target Name FABP5
    Gene ID 2171, 16592, 701009, 140868, 101086698, 477923, 281760, 100057538
    Gene Symbol and Synonyms C-FABP,DA11,E-FABP,EFABP,FABP5,FABP5L2,FABP5L7,Fabpe,KFABP,Klbp,mal1,PA-FABP,PAFABP
    Uniprot Accession Q01469
    Uniprot Entry Name FABP5_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target
    Disease Breast Cancer
    Gene Ensembl ENSG00000164687
    Target Classification Not Available

    This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.