Human FABP5/E-FABP/EFABP ORF/cDNA clone-Lentivirus particle (NM_001444)
Cat. No.: vGMLP004328
Pre-made Human FABP5/E-FABP/EFABP Lentiviral expression plasmid for FABP5 lentivirus packaging, FABP5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
FABP5/E-FABP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP004328 | Human FABP5 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP004328 |
Gene Name | FABP5 |
Accession Number | NM_001444 |
Gene ID | 2171 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 408 bp |
Gene Alias | E-FABP,EFABP,KFABP,PA-FABP,PAFABP |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCACAGTTCAGCAGCTGGAAGGAAGATGGCGCCTGGTGGACAGCAAAGGCTTTGATGAATACATGAAGGAGCTAGGAGTGGGAATAGCTTTGCGAAAAATGGGCGCAATGGCCAAGCCAGATTGTATCATCACTTGTGATGGTAAAAACCTCACCATAAAAACTGAGAGCACTTTGAAAACAACACAGTTTTCTTGTACCCTGGGAGAGAAGTTTGAAGAAACCACAGCTGATGGCAGAAAAACTCAGACTGTCTGCAACTTTACAGATGGTGCATTGGTTCAGCATCAGGAGTGGGATGGGAAGGAAAGCACAATAACAAGAAAATTGAAAGATGGGAAATTAGTGGTGGAGTGTGTCATGAACAATGTCACCTGTACTCGGATCTATGAAAAAGTAGAATAA |
ORF Protein Sequence | MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T21507-Ab | Anti-FABP5/ E-FABP/ EFABP monoclonal antibody |
Target Antigen | GM-Tg-g-T21507-Ag | FABP5 VLP (virus-like particle) |
ORF Viral Vector | pGMLP004328 | Human FABP5 Lentivirus plasmid |
ORF Viral Vector | pGMAD000803 | Human FABP5 Adenovirus plasmid |
ORF Viral Vector | pGMPC001524 | Human FABP5 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP004328 | Human FABP5 Lentivirus particle |
ORF Viral Vector | vGMAD000803 | Human FABP5 Adenovirus particle |
Target information
Target ID | GM-T21507 |
Target Name | FABP5 |
Gene ID | 2171, 16592, 701009, 140868, 101086698, 477923, 281760, 100057538 |
Gene Symbol and Synonyms | C-FABP,DA11,E-FABP,EFABP,FABP5,FABP5L2,FABP5L7,Fabpe,KFABP,Klbp,mal1,PA-FABP,PAFABP |
Uniprot Accession | Q01469 |
Uniprot Entry Name | FABP5_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target |
Disease | Breast Cancer |
Gene Ensembl | ENSG00000164687 |
Target Classification | Not Available |
This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.