Human COPS5/CSN5/JAB1 ORF/cDNA clone-Lentivirus plasmid (NM_006837)

Cat. No.: pGMLP000130
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human COPS5/CSN5/JAB1 Lentiviral expression plasmid for COPS5 lentivirus packaging, COPS5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.


Target products collection

Go to COPS5/CSN5 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $581.4
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLP000130
Gene Name COPS5
Accession Number NM_006837
Gene ID 10987
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1005 bp
Gene Alias CSN5,JAB1,MOV-34,SGN5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGTCCGGGAGCGGTATGGCCCAGAAAACCTGGGAACTGGCCAACAACATGCAGGAAGCTCAGAGTATCGATGAAATCTACAAATACGACAAGAAACAGCAGCAAGAAATCCTGGCGGCGAAGCCCTGGACTAAGGATCACCATTACTTTAAGTACTGCAAAATCTCAGCATTGGCTCTGCTGAAGATGGTGATGCATGCCAGATCGGGAGGCAACTTGGAAGTGATGGGTCTGATGCTAGGAAAGGTGGATGGTGAAACCATGATCATTATGGACAGTTTTGCTTTGCCTGTGGAGGGCACTGAAACCCGAGTAAATGCTCAGGCTGCTGCATATGAATACATGGCTGCATACATAGAAAATGCAAAACAGGTTGGCCGCCTTGAAAATGCAATCGGGTGGTATCATAGCCACCCTGGCTATGGCTGCTGGCTTTCTGGGATTGATGTTAGTACTCAGATGCTCAATCAGCAGTTCCAGGAACCATTTGTAGCAGTGGTGATTGATCCAACAAGAACAATATCCGCAGGGAAAGTGAATCTTGGCGCCTTTAGGACATACCCAAAGGGCTACAAACCTCCTGATGAAGGACCTTCTGAGTACCAGACTATTCCACTTAATAAAATAGAAGATTTTGGTGTACACTGCAAACAATATTATGCCTTAGAAGTCTCATATTTCAAATCCTCTTTGGATCGCAAATTGCTTGAGCTGTTGTGGAATAAATACTGGGTGAATACGTTGAGTTCTTCTAGCTTGCTTACTAATGCAGACTATACCACTGGTCAGGTCTTTGATTTGTCTGAAAAGTTAGAGCAGTCAGAAGCCCAGCTGGGACGAGGGAGTTTCATGTTGGGTTTAGAAACGCATGACCGAAAATCAGAAGACAAACTTGCCAAAGCTACAAGAGACAGCTGTAAAACTACCATAGAAGCTATCCATGGATTGATGTCTCAGGTTATTAAGGATAAACTGTTTAATCAAATTAACATCTCTTAA
ORF Protein Sequence MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSLLTNADYTTGQVFDLSEKLEQSEAQLGRGSFMLGLETHDRKSEDKLAKATRDSCKTTIEAIHGLMSQVIKDKLFNQINIS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T84791-Ab Anti-COPS5 monoclonal antibody
    Target Antigen GM-Tg-g-T84791-Ag COPS5 protein
    ORF Viral Vector pGMLP000130 Human COPS5 Lentivirus plasmid
    ORF Viral Vector pGMLP003876 Human COPS5 Lentivirus plasmid
    ORF Viral Vector vGMLP000130 Human COPS5 Lentivirus particle
    ORF Viral Vector vGMLP003876 Human COPS5 Lentivirus particle


    Target information

    Target ID GM-T84791
    Target Name COPS5
    Gene ID 10987, 26754, 704584, 312916, 101092084, 477901, 507179, 100051846
    Gene Symbol and Synonyms COPS5,CSN5,JAB1,MOV-34,Mov34,SGN5
    Uniprot Accession Q92905
    Uniprot Entry Name CSN5_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Cancer
    Gene Ensembl ENSG00000121022
    Target Classification Tumor-associated antigen (TAA)

    The protein encoded by this gene is one of the eight subunits of COP9 signalosome, a highly conserved protein complex that functions as an important regulator in multiple signaling pathways. The structure and function of COP9 signalosome is similar to that of the 19S regulatory particle of 26S proteasome. COP9 signalosome has been shown to interact with SCF-type E3 ubiquitin ligases and act as a positive regulator of E3 ubiquitin ligases. This protein is reported to be involved in the degradation of  cyclin-dependent kinase inhibitor CDKN1B/p27Kip1. It is also known to be an coactivator that increases the specificity of JUN/AP1 transcription factors. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.